Mouse CD8b Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 86024-1-RR (same clone as 86024-1-PBS)

  Mouse thymus tissue was subjected to SDS PAGE followed by western blot with 86024-1-RR (CD8 beta antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86024-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 86024-1-RR (same clone as 86024-1-PBS)

  Mouse spleen tissue was subjected to SDS PAGE followed by western blot with 86024-1-RR (CD8 beta antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86024-1-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02794-1

  The mean CD8b concentration was determined to be 157.0 ng/mL in Mouse thymus tissue extract based on a 5.8 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02794-1

  Cytometric bead array standard curve of MP02794-1, MOUSE CD8b Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86024-1-PBS. Detection antibody: 86024-2-PBS. Standard: Eg4275. Range: 0.625-80 ng/mL.

CD8b Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 86024-1-PBS

Clone No.250480F2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

Cd8b1, Ly-3, Lymphocyte antigen 3, Lyt3, Lyt-3

---

Product Information

86024-1-PBS targets CD8b as part of a matched antibody pair:

MP02794-1: 86024-1-PBS capture and 86024-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4275

  Product name: Recombinant Mouse CD8B protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 22-175 aa of NM_009858.2

  Sequence: LIQTPSSLLVQTNHTAKMSCEVKSISKLTSIYWLRERQDPKDKYFEFLASWSSSKGVLYGESVDKKRNIILESSDSRRPFLSIMNVKPEDSDFYFCATVGSPKMVFGTGTKLTVVDVLPTTAPTKKTTLKMKKKKQCPFPHPETQKGLTCSLTT

• Full Name: CD8 antigen, beta chain 1
• Calculated Molecular Weight: 24 kDa
• Observed Molecular Weight: 26-30 kDa
• GenBank Accession Number: NM_009858.2
• Gene Symbol: Cd8b1
• Gene ID (NCBI): 12526
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P10300
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CD8b (T-cell surface glycoprotein CD8 beta chain) is an integral membrane glycoprotein that forms disulfide-linked heterodimers with CD8a (CD8 alpha chain). The CD8 alpha/beta heterodimer is the predominant CD8 complex expressed on the cell surface (PMID: 1534146; 2111591). CD8 is a transmembrane glycoprotein predominantly expressed on cytotoxic T cells and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells.