Use Able AI chat for product recommendations

CoraLite® Plus 594 Anti-Mouse CD8b Rabbit Recombinant Antibody

CD8b Uni-rAb® Recombinant Antibody for FC

Cat No. CL594-98461-3
Clone No.250480F2

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

Cd8b1, Ly-3, Lymphocyte antigen 3, Lyt3, Lyt-3

Formulation:  PBS, Azide
PBS, Azide
Conjugate:  CoraLite® Plus 594
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inmouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in a 100 µl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-98461-3 targets CD8b in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg4275

Product name: Recombinant Mouse CD8B protein (rFc Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-rFc

Tag: C-rFc

Domain: 22-175 aa of NM_009858.2

Sequence: LIQTPSSLLVQTNHTAKMSCEVKSISKLTSIYWLRERQDPKDKYFEFLASWSSSKGVLYGESVDKKRNIILESSDSRRPFLSIMNVKPEDSDFYFCATVGSPKMVFGTGTKLTVVDVLPTTAPTKKTTLKMKKKKQCPFPHPETQKGLTCSLTT

Predict reactive species
Full Name CD8 antigen, beta chain 1
Calculated Molecular Weight24 kDa
GenBank Accession NumberNM_009858.2
Gene Symbol Cd8b1
Gene ID (NCBI) 12526
RRIDAB_3748456
Conjugate CoraLite® Plus 594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP10300
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

CD8b (T-cell surface glycoprotein CD8 beta chain) is an integral membrane glycoprotein that forms disulfide-linked heterodimers with CD8a (CD8 alpha chain). The CD8 alpha/beta heterodimer is the predominant CD8 complex expressed on the cell surface (PMID: 1534146; 2111591). CD8 is a transmembrane glycoprotein predominantly expressed on the surface of cytotoxic T cells and can also be found on natural killer cells, cortical thymocytes, and dendritic cells. CD8 serves as a co-receptor for the T cell receptor (TCR). Both CD8 and TCR recognize antigens displayed by an antigen presenting cell (APC) in the context of class I MHC molecules. CD8 plays a role in T cell development and activation of mature T cells.

Protocols

Product Specific Protocols
FC protocol for CL Plus 594 CD8b antibody CL594-98461-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...