Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated CD9 Recombinant monoclonal antibody

CD9 Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-84142
Clone No.240830A8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

240830A8, 5H9, 5H9 antigen, BA2, BTCC 1

Formulation:  PBS, Proclin300, BSA, Glycerol
PBS, Proclin300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84142 targets CD9 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1037

Product name: recombinant human CD9 protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 112-195 aa of NM_001769.4

Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

Predict reactive species
Full Name CD9 molecule
Calculated Molecular Weight25 kDa
Observed Molecular Weight23 kDa
GenBank Accession NumberNM_001769.4
Gene Symbol CD9
Gene ID (NCBI) 928
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21926
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405). The CD9 antigen appears to be a 227-amino acid molecule with four hydrophobic domains and one N-glycosylation site (PMID: 1840589). This antibody detects bands of 23-30 kDa, which may be due to the difference in glycosylations (PMID: 8701996).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CD9 antibody CL488-84142Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...