CoraLite® Plus 488 Anti-Human CD9 Rabbit Recombinant Antibody

• 

  FC experiment of human PBMCs using CL488-98095

  1x10^6 human PBMCs were surface stained with APC Anti-Human CD3 and 5 ul CoraLite® Plus 488 Anti-Human CD9 Rabbit Recombinant Antibody (CL488-98095, Clone:240830E6), or CoraLite® Plus 488 Rabbit IgG Isotype Control Recombinant Antibody (CL488-98136, Clone: 240953C9).Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of human PBMCs using CL488-98095

  1x10^6 human PBMCs were surface stained with 5 ul CoraLite® Plus 488 Anti-Human CD9 Rabbit Recombinant Antibody (CL488-98095, Clone:240830E6)(red), or CoraLite® Plus 488 Rabbit IgG Isotype Control Recombinant Antibody (CL488-98136, Clone: 240953C9)(blue).Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

CD9 Uni-rAb^® Recombinant Antibody for FC

Cat No. CL488-98095

Clone No.240830E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

240830E6, 5H9, 5H9 antigen, BA2, BTCC 1

---

Tested Applications

• Positive FC detected in: human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in 100 μl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-98095 targets CD9 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1037

  Product name: recombinant human CD9 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 112-195 aa of NM_001769.4

  Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

• Full Name: CD9 molecule
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: NM_001769.4
• Gene Symbol: CD9
• Gene ID (NCBI): 928
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P21926
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405).