• Zero Fc receptor binding
  • Site-specific conjugation
  • One universal isotype

FcZero-rAb™ CoraLite® Plus 488 Anti-Human CD9 Rabbit Recombinant Antibody

CD9 FcZero-rAbTM Recombinant Antibody for FC
Cat No. CL488-FcA98095
Clone No.240830E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

240830E6, 5H9, 5H9 antigen, BA2, BTCC 1

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inhuman PBMCs

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 5 ul per 10^6 cells in a 100 µl suspension
This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-FcA98095 targets CD9 in FC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1037

Product name: recombinant human CD9 protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 112-195 aa of NM_001769.4

Sequence: SHKDEVIKEVQEFYKDTYNKLKTKDEPQRETLKAIHYALNCCGLAGGVEQFISDICPKKDVLETFTVKSCPDAIKEVFDNKFHI

Predict reactive species
Full Name CD9 molecule
Calculated Molecular Weight25 kDa
GenBank Accession NumberNM_001769.4
Gene Symbol CD9
Gene ID (NCBI) 928
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths491 nm / 516 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP21926
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

The cell-surface molecule CD9, a member of the transmembrane-4 superfamily, interacts with the integrin family and other membrane proteins, and is postulated to participate in cell migration and adhesion. Expression of CD9 enhances membrane fusion between muscle cells and promotes viral infection in some cells (PMID:10459022). It is often used as a mesenchymal stem cell marker (PMID:18005405).

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 CD9 antibody CL488-FcA98095Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...