Rat CD90 Recombinant monoclonal antibody, PBS Only (Capture)

CD90 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA
Cat No. 84206-3-PBS
Clone No.241388E2

Host / Isotype

Rabbit / IgG

Reactivity

rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

241388E2, Thy1, Thy-1, Thy-1 antigen, Thy-1 membrane glycoprotein

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84206-3-PBS targets CD90 as part of a matched antibody pair:

MP01132-1: 84206-3-PBS capture and 84206-1-PBS detection (validated in Cytometric bead array)

MP01132-2: 84206-3-PBS capture and 84206-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg1463

Product name: Recombinant Rat CD90/Thy1 protein (His Tag)

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 20-130 aa of NM_012673.2

Sequence: QRVISLTACLVNQNLRLDCRHENNTNLPIQHEFSLTREKKKHVLSGTLGVPEHTYRSRVNLFSDRFIKVLTLANFTTKDEGDYMCELRVSGQNPTSSNKTINVIRDKLVKC

Predict reactive species
Full Name Thy-1 cell surface antigen
Calculated Molecular Weight18 kDa
Observed Molecular Weight25 kDa
GenBank Accession NumberNM_012673.2
Gene Symbol Thy1
Gene ID (NCBI) 24832
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP01830
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CD90, also known as THY1, is a 25-35 kD protein that is expressed on 1-4% of human fetal liver cells, cord blood cells, and bone marrow cells. CD90 is one of the essential surface molecules expressed on human MSC from bone marrow and other sources. Activation of Thy-1 has been reported to promote T cell activation. It also affects numerous nonimmunologic biological processes, including cellular adhesion, neurite outgrowth, tumor growth, migration, and cell death.

Loading...
||
New chat

Able

正在加载,请稍候...