CDC14A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CDC14A Polyclonal antibody, PBS Only (13660-1-PBS)

• 

  WB analysis of human heart using 13660-1-AP (same clone as 13660-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 13660-1-AP (CDC14A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13660-1-PBS in a different storage buffer formulation.

• 

  WB analysis of COLO 320 using 13660-1-AP (same clone as 13660-1-PBS)

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 13660-1-AP (CDC14A antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13660-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 13660-1-AP (same clone as 13660-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 13660-1-AP (CDC14A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13660-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 13660-1-AP (same clone as 13660-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 13660-1-AP (CDC14A antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13660-1-PBS in a different storage buffer formulation.

CDC14A Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13660-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

13660-1-PBS targets CDC14A in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4556

  Product name: Recombinant human CDC14A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-191 aa of BC038979

  Sequence: MAAESGELIGACEFMKDRLYFATLRNRPKSTVNTHYFSIDEELVYENFYADFGPLNLAMVYRYCCKLNKKLKSYSLSRKKIVHYTCFDQRKRANAAFLIGAYAVIYLKKTPEEAYRALLSGSNPPYLPFRDASFGNCTYNLTILDCLQGIRKGLQHGFFDFETFDVDEYEHYEVILFTPLKPTFLISKSIM

• Full Name: CDC14 cell division cycle 14 homolog A (S. cerevisiae)
• Calculated Molecular Weight: 594 aa, 66 kDa
• Observed Molecular Weight: 66 kDa
• GenBank Accession Number: BC038979
• Gene Symbol: CDC14A
• Gene ID (NCBI): 8556
• RRID: AB_2260218
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UNH5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.