CDC20 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CDC20 Polyclonal antibody, PBS Only (30451-1-PBS)

• 

  WB analysis using 30451-1-AP (same clone as 30451-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 30451-1-AP (CDC20 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30451-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 30451-1-AP (same clone as 30451-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 30451-1-AP (CDC20 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30451-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U2OS using 30451-1-AP (same clone as 30451-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed U2OS cells using CDC20 antibody (30451-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 30451-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 30451-1-AP (same clone as 30451-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using CDC20 antibody (30451-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 30451-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 30451-1-AP (same clone as 30451-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using CDC20 antibody (30451-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 30451-1-PBS in a different storage buffer formulation.

CDC20 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 30451-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

30451-1-PBS targets CDC20 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32712

  Product name: Recombinant human CDC20 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-176 aa of BC001088

  Sequence: MAQFAFESDLHSLLQLDAPIPNAPPARWQRKAKEAAGPAPSPMRAANRSHSAGRTPGRTPGKSSSKVQTTPSKPGGDRYIPHRSAAQMEVASFLLSKENQPENSQTPTKKEHQKAWALNLNGFDVEEAKILRLSGKPQNAPEGYQNRLKVLYSQKATPGSSRKTCRYIPSLPDRIL

• Full Name: cell division cycle 20 homolog (S. cerevisiae)
• Calculated Molecular Weight: 55 kDa
• Observed Molecular Weight: 51 kDa
• GenBank Accession Number: BC001088
• Gene Symbol: CDC20
• Gene ID (NCBI): 991
• RRID: AB_3086319
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q12834
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cdc20 (Cell-division cycle protein 20 homologue) is also named as p55CDC and belongs to the WD repeat CDC20/Fizzy family. Cdc20 has important functions in chromosome segregation and mitotic exit. Cdc20 is the target of the spindle assembly checkpoint (SAC) and a key cofactor of the anaphase-promoting complex or cyclosome (APC/CCDC20) E3 ubiquitin ligase, thus regulating APC/C ubiquitin activity on specific substrates for their subsequent degradation by the proteasome (PMID: 28202332). The 55-kDa band corresponded to the size of Cdc20 (PMID: 22566641).