CDC42EP2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CDC42EP2 Polyclonal antibody (11824-1-AP)

CDC42EP2 Polyclonal Antibody for WB, ELISA

Cat No. 11824-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

BORG1, Cdc42 effector protein 2, CEP2

• 

  WB analysis of K-562 using 11824-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 11824-1-AP (CDC42EP2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse pancreas using 11824-1-AP

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 11824-1-AP (CDC42EP2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: K-562 cells, mouse pancreas tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11824-1-AP targets CDC42EP2 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2392

  Product name: Recombinant human CDC42EP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-210 aa of BC022337

  Sequence: MSTKVPIYLKRGSRKGKKEKLRDLLSSDMISPPLGDFRHTIHIGSGGGSDMFGDISFLQGKFHLLPGTMVEGPEEDGTFDLPFQFTRTATVCGRELPDGPSPLLKNAISLPVIGGPQALTLPTAQAPPKPPRLHLETPQPSPQEGGSVDIWRIPETGSPNSGLTPESGAEEPFLSNASSLLSLHVDLGPSILDDVLQIMDQDLDSMQIPT

• Full Name: CDC42 effector protein (Rho GTPase binding) 2
• Calculated Molecular Weight: 22 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC022337
• Gene Symbol: CDC42EP2
• Gene ID (NCBI): 10435
• RRID: AB_10793663
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14613
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDC42EP2 (CDC42 Effector Protein 2) is a protein-coding gene that belongs to the Borg family of CDC42 effector proteins. The protein it encodes contains a CRIB (Cdc42/Rac interactive-binding) domain, which mediates its interaction with CDC42, a small Rho GTPase that regulates the formation of F-actin-containing structures. Through this binding, CDC42EP2 is thought to play a role in actin filament assembly and cell shape control, and it appears to negatively regulate CDC42 function. The gene is also known by the aliases CEP2 and BORG1, and is located on chromosome 11q12-q13. Its expression is ubiquitous but variable, with notably high levels in the heart and lower levels in the pancreas and liver.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Glia; CDC42-Effector Proteins Regulate Higher Order Structure of Septins Required for CNS Myelin Integrity.; Authors - Sophie Hümmert