Filter:
Product Information
12427-1-PBS targets CDC42SE1 in IHC, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3098 Product name: Recombinant human CDC42SE1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC012796 Sequence: MSEFWHKLGCCVVEKPQPKKKRRRIDRTMIGEPMNFVHLTHIGSGEMGAGDGLAMTGAVQEQMRSKGNRDRPWSNSRGL Predict reactive species |
| Full Name | CDC42 small effector 1 |
| Calculated Molecular Weight | 79 aa, 9 kDa |
| GenBank Accession Number | BC012796 |
| Gene Symbol | CDC42SE1 |
| Gene ID (NCBI) | 56882 |
| RRID | AB_3669138 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NRR8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
CDC42SE1, also known as SPEC1, is a small effector protein of 9 kDa. CDC42SE1 consists of 79 amino acids, including a conserved CRIB domain, 2 conserved cysteines at the N-terminus, and a basic amino acid before the CRIB domain. CDC42SE1 has been shown to inhibit CDC42-induced JNK activity and cell morphological changes in COS1 cells (PMID: 23957315).
