CDCA5 Monoclonal antibody, PBS Only

• 

  WB analysis using 67418-1-Ig (same clone as 67418-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67418-1-Ig (CDCA5 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67418-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67418-1-Ig (same clone as 67418-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67418-1-Ig (CDCA5 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67418-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 67418-1-Ig (same clone as 67418-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 67418-1-Ig (CDCA5 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67418-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67418-1-Ig (same clone as 67418-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67418-1-Ig (CDCA5 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67418-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67418-1-Ig (same clone as 67418-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67418-1-Ig (CDCA5 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67418-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67418-1-Ig (same clone as 67418-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67418-1-Ig (CDCA5 antibody) at dilution of 1:300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67418-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 67418-1-Ig (same clone as 67418-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 67418-1-Ig (CDCA5 antibody) at dilution of 1:300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67418-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 67418-1-Ig (same clone as 67418-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CDCA5 antibody (67418-1-Ig, Clone: 2G1D2 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67418-1-PBS in a different storage buffer formulation.

CDCA5 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 67418-1-PBS

Clone No.2G1D2

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CDCA5, p35, SORORIN

---

Product Information

67418-1-PBS targets CDCA5 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28958

  Product name: Recombinant human CDCA5 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-252 aa of BC011000

  Sequence: MSGRRTRSGGAAQRSGPRAPSPTKPLRRSQRKSGSELPSILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVRRSYSRLETLGSASTSTPGRRSCFGFEGLLGAEDLSGVSPVVCSKLTEVPRVCAKPWAPDMTLPGISPPPEKQKRKKKKMPEILKTELDEWAAAMNAEFEAAEQFDLLVE

• Full Name: cell division cycle associated 5
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 35 kDa
• GenBank Accession Number: BC011000
• Gene Symbol: CDCA5
• Gene ID (NCBI): 113130
• RRID: AB_2882658
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96FF9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Human cell division cycle associated 5 (CDCA5), also known as Sororin, is required for stable binding of cohesin to chromatid in the S and G2/M phases and degraded through anaphase-promoting complex-dependent ubiquitination in the G0/G1 phase (PMID: 30808873). Suppression of CDCA5 expression with siRNAs inhibited the growth of lung cancer cells. CDCA5 positivity is an independent prognostic factor for lung cancer patients (PMID: 20551060). The predicted molecular size of CDCA is 27 kd, with an electrophoretic mobility of ~35 kd on SDS-PAGE, possibly due to its isoelectric point (pI) of approximately 10 (PMID: 22580470).