CDH9 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CDH9 Polyclonal antibody, PBS Only (21737-1-PBS)

• 

  WB analysis using 21737-1-AP (same clone as 21737-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 21737-1-AP (CDH9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21737-1-PBS in a different storage buffer formulation.

CDH9 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21737-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Cadherin 9, Cadherin-9

---

Product Information

21737-1-PBS targets CDH9 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16437

  Product name: Recombinant human CDH9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 469-541 aa of BC113745

  Sequence: SSHIPVFIRILDINDHAPEFAMYYETFVCENAKPGQLIQTVSVMDKDDPPRGHKFFFEPVPEFTLNPNFTIVD

• Full Name: cadherin 9, type 2 (T1-cadherin)
• Calculated Molecular Weight: 789 aa, 89 kDa
• Observed Molecular Weight: 107 kDa
• GenBank Accession Number: BC113745
• Gene Symbol: CDH9
• Gene ID (NCBI): 1007
• RRID: AB_3742054
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULB4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CDH9, also known as Cadherin 9, is a type of cadherin that plays a significant role in cell adhesion and tissue organization. It is a member of the cadherin superfamily, which is a group of transmembrane glycoproteins that mediate cell-cell adhesion. (PMID: 36315446)