CoraLite® Plus 488-conjugated CDK12/CRKRS Recombinant monoclonal antibody

CDK12/CRKRS Uni-rAb® Recombinant Antibody for IF/ICC
Cat No. CL488-86296-3
Clone No.250880E5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

CrkRS, CDC2 related protein kinase 7, Cdc2-related kinase, arginine/serine-rich, CDC2-related protein kinase 7, CDK12

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inNIH/3T3 cells, A431 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-86296-3 targets CDK12/CRKRS in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag25312

Product name: Recombinant human CRKRS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1300-1481 aa of BC150265

Sequence: EAEPPGHLPHEHQALRPMEYSTRPRPNRTYGNTDGPETGFSAIDTDERNSGPALTESLVQTLVKNRTFSGSLSHLGESSSYQGTGSVQFPGDQDLRFARVPLALHPVVGQPFLKAEGSSNSVVHAETKLQNYGELGPGTTGASSSGAGLHWGGPTQSSAYGKLYRGPTRVPPRGGRGRGVPY

Predict reactive species
Full Name Cdc2-related kinase, arginine/serine-rich
Calculated Molecular Weight 1490 aa, 164 kDa
Observed Molecular Weight 180-200 kDa
GenBank Accession NumberBC150265
Gene Symbol CDK12
Gene ID (NCBI) 51755
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NYV4
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CRKRS (Cdc2-related kinase, Arg/Ser), also named as cyclin-dependent kinase 12 (CKD12), belongs to CDC2/CDKX subfamily. CDK12 can form a heterodimeric complex with its activating partner, cyclin K, to regulate important cellular physiological processes that include transcriptional regulation, regulation of DNA damage repair genes such as BRCA1 and ATM, suppression of intronic polyadenylation, and susceptibility to PARP inhibitors (PMID: 30487607, 24240700, 31694772). CDK12 has 3 isoforms with the calculated molecular mass of 164/163/141 kDa, and the apparent molecular mass of 180-200 kDa due to some modifications (PMID 11683387, 22988298).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CDK12/CRKRS antibody CL488-86296-3Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...