CDK17 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CDK17 Polyclonal antibody, PBS Only (29214-1-PBS)

• 

  WB analysis using 29214-1-AP (same clone as 29214-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29214-1-AP (CDK17 antibody) at dilution of 1:600 and incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29214-1-PBS in a different storage buffer formulation.

CDK17 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 29214-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

29214-1-PBS targets CDK17 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30200

  Product name: Recombinant human CDK17 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-100 aa of NM_002595

  Sequence: MKKFKRRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHEN

• Full Name: PCTAIRE protein kinase 2
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: NM_002595
• Gene Symbol: CDK17
• Gene ID (NCBI): 5128
• RRID: AB_2935472
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00537
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cyclin-dependent kinase 17 (CDK17) belongs to the protein kinase superfamily. It may play a role in terminally differentiated neurons and has a Ser/Thr-phosphorylating activity for histone H1. CDK17 can be detected as 60 kDa.