Use Able AI chat for product recommendations

CoraLite® Plus 488-conjugated CDK2 Recombinant monoclonal antibody

CDK2 Uni-rAb® Recombinant Antibody for IF/ICC

Cat No. CL488-83635-5
Clone No.240580A6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

CDKN2, Cell division protein kinase 2, Cyclin dependent kinase 2, Cyclin-dependent kinase 2, EC:2.7.11.22

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83635-5 targets CDK2 in IF/ICC applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag17133

Product name: Recombinant human CDK2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 217-298 aa of BC003065

Sequence: RTLGTPDEVVWPGVTSMPDYKPSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRISAKAALAHPFFQDVTKPVPHLRL

Predict reactive species
Full Name cyclin-dependent kinase 2
Calculated Molecular Weight 298 aa, 34 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC003065
Gene Symbol CDK2
Gene ID (NCBI) 1017
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
Excitation LaserBlue laser (488 nm)
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP24941
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CDK2(Cyclin-dependent kinase 2) is also named as CDKN2 and belongs to the protein kinase superfamily. It is dispensable for myelination but is important for adult oligodendrocyte progenitor cell renewal, and could be one of the underlying mechanisms that drive adult progenitors to differentiate and thus regenerate myelin(PMID:21502361). G2 phase CCNA1/CDK2 controls the timing of entry into mitosis by controlling the subsequent activation of CCNB/CDK1, but also has an unexpected role in coordinating the activation of CCNB/CDK1 at the centrosome and in the nucleus(PMID:18372919).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CDK2 antibody CL488-83635-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...