CDK2AP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CDK2AP2 Polyclonal antibody, PBS Only (15423-1-PBS)

• 

  WB analysis of HeLa using 15423-1-AP (same clone as 15423-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15423-1-AP (CDK2AP2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15423-1-PBS in a different storage buffer formulation.

CDK2AP2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 15423-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

15423-1-PBS targets CDK2AP2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7730

  Product name: Recombinant human CDK2AP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-126 aa of BC002850

  Sequence: MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART

• Full Name: cyclin-dependent kinase 2 associated protein 2
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC002850
• Gene Symbol: CDK2AP2
• Gene ID (NCBI): 10263
• RRID: AB_2878135
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75956
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.