CDK2AP2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CDK2AP2 Polyclonal antibody, PBS Only (15423-1-PBS)

CDK2AP2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 15423-1-PBS Copied!

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

CDK2 associated protein 2, CDK2-associated protein 2, Cyclin-dependent kinase 2-associated protein 2, DOC 1 related protein, DOC 1R

• 

  WB analysis of HeLa using 15423-1-AP (same clone as 15423-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15423-1-AP (CDK2AP2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15423-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse intestine using 15423-1-AP (same clone as 15423-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse intestine tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15423-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 15423-1-AP (same clone as 15423-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15423-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human ovary tumor using 15423-1-AP (same clone as 15423-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15423-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 15423-1-AP (same clone as 15423-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15423-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 15423-1-AP (same clone as 15423-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15423-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse adrenal gland using 15423-1-AP (same clone as 15423-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse adrenal gland tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15423-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 15423-1-AP (same clone as 15423-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15423-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat adrenal gland using 15423-1-AP (same clone as 15423-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat adrenal gland tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15423-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat small intestine using 15423-1-AP (same clone as 15423-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 15423-1-AP (CDK2AP2 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15423-1-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CDK2AP2 in ?

Chat with Able

---

Product Information

15423-1-PBS targets CDK2AP2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7730

  Product name: Recombinant human CDK2AP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-126 aa of BC002850

  Sequence: MSYKPIAPAPSSTPGSSTPGPGTPVPTGSVPSPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMGKEIRPTYAGSKSAMERLKRGIIHARALVRECLAETERNART

• Full Name: cyclin-dependent kinase 2 associated protein 2
• Calculated Molecular Weight: 13 kDa
• Observed Molecular Weight: 16 kDa
• GenBank Accession Number: BC002850
• Gene Symbol: CDK2AP2
• Gene ID (NCBI): 10263
• RRID: AB_2878135
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75956
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.