CDK4 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CDK4 Polyclonal antibody (11026-1-AP)

• Featured Product
• KD/KO Validated

CDK4 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 11026-1-AP Copied!

Publications (576)

Reviews (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA

Synonyms

Cell division protein kinase 4, CMM3, cyclin dependent kinase 4, Cyclin-dependent kinase 4, EC:2.7.11.22

• 

  WB analysis using 11026-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11026-1-AP (CDK4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11026-1-AP

  WB result of CDK4 antibody (11026-1-AP; 1:8000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CDK4 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11026-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11026-1-AP (CDK4 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat pancreas using 11026-1-AP

  rat pancreas tissue were subjected to SDS PAGE followed by western blot with 11026-1-AP (CDK4 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 11026-1-AP

  IP result of anti-CDK4 (IP:11026-1-AP, 3ug; Detection:11026-1-AP 1:1000) with HeLa cells lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 11026-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11026-1-AP (CDK4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 11026-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11026-1-AP (CDK4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 11026-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11026-1-AP (CDK4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung cancer using 11026-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 11026-1-AP (CDK4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 11026-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11026-1-AP (CDK4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 11026-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11026-1-AP (CDK4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MCF-7 using 11026-1-AP

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using CDK4 antibody (11026-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of MCF-7 using 11026-1-AP

  1x10^6 MCF-7 cells were intracellularly stained with 0.8 ug CDK4 Polyclonal antibody (11026-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.8 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CDK4 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, rat pancreas tissue, HepG2 cells, MCF-7 cells, NIH/3T3 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human lung cancer tissue, human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11026-1-AP targets CDK4 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, rabbit, canine, zebrafish, bovine, sheep
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1505

  Product name: Recombinant human CDK4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-303 aa of BC010153

  Sequence: MATSRYEPVAEIGVGAYGTVYKARDPHSGHFVALKSVRVPNGGGGGGGLPISTVREVALLRRLEAFEHPNVVRLMDVCATSRTDREIKVTLVFEHVDQDLRTYLDKAPPPGLPAETIKDLMRQFLRGLDFLHANCIVHRDLKPENILVTSGGTVKLADFGLARIYSYQMALTPVVVTLWYRAPEVLLQSTYATPVDMWSVGCIFAEMFRRKPLFCGNSEADQLGKIFDLIGLPPEDDWPRDVSLPRGAFPPRGPRPVQSVVPEMEESGAQLLLEMLTFNPHKRISAFRALQHSYLHKDEGNPE

• Full Name: cyclin-dependent kinase 4
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 30-34 kDa
• GenBank Accession Number: BC010153
• Gene Symbol: CDK4
• Gene ID (NCBI): 1019
• RRID: AB_2078702
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P11802
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin-dependent kinase-4 (CDK4) is a protein-serine kinase involved in the cell cycle. It is essential for the G1- to S-phase transition during the cell cycle and its expression is primarily controlled at the transcriptional level(PMID:17253961). CCND1-CDK4 axis is not only critical in glial tumor cells but also in stromal-derived cells in the surrounding tumor microenvironment that are vital to sustain tumor outgrowth(PMID:21844184).

Publications

What published studies show

The CDK4 Polyclonal antibody (catalog no. 11026-1-AP) has 576 total citations. These appear in high-impact journals including Nature, Nature Communications, Molecular Cancer, Cancer Research, Cell Death & Disease, Cell Reports, Science Advances, Oncogene, and Journal of Medicinal Chemistry. Research fields span oncology (breast, lung, gastric, bladder, liver, and other cancers), cell cycle regulation, CDK4/6 inhibitor therapy, drug discovery, and regenerative/cardiovascular biology.

Automatically generated from the 576 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Nature; SMYD5 methylation of rpL40 links ribosomal output to gastric cancer; Authors - Juhyung Park
human	WB	Mol Cancer; CDK6/4 inactivates BAP1 deubiquitinase destabilizing VHL to promote metastatic colonization in liver.; Authors - Bei Jin
human	WB	Mol Cancer; Circular RNA BCRC-3 suppresses bladder cancer proliferation through miR-182-5p/p27 axis.; Authors - Fei Xie
human	WB,IHC	Mol Cancer; The circACTN4 interacts with FUBP1 to promote tumorigenesis and progression of breast cancer by regulating the expression of proto-oncogene MYC.; Authors - Xiaosong Wang
human	WB	Mol Cancer; Long non-coding RNA PVT1 promotes tumor progression by regulating the miR-143/HK2 axis in gallbladder cancer.; Authors - Jianan Chen
human	WB,IF	Mol Cancer; S6K1 amplification confers innate resistance to CDK4/6 inhibitors through activating c-Myc pathway in patients with estrogen receptor-positive breast cancer; Authors - Hongnan Mo

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

The product received one review with a 4-star rating. The reviewer used it for Western Blot on bladder tissue and reported obtaining a very good band, indicating strong and clear detection performance in their application.

Automatically generated from the 1 verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Prakash (Verified Customer) (10-28-2025)

very good band in western blot

• Applications: Western Blot
• Cell Tissue Type: Bladder tissue