Use Able AI chat for product recommendations

CDK5R1 Monoclonal antibody

CDK5R1 Monoclonal Antibody for WB, IHC, ELISA

Cat No. 67503-1-Ig
Clone No. 1A3A5
Publications (6)
Reviews (1)
Download datasheet

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat, pig, rabbit and More (1)

Applications

WB, IHC, IF, CoIP, ELISA

CDK5 activator 1, CDK5P35, CDK5R, CDK5R1, NCK5A, p23, p25, p35, p35nck5a, TPKII regulatory subunit

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for CDK5R1 in ?

Tested Applications

Positive WB detected inpig cerebellum tissue, pig brain tissue, rat brain tissue, mouse brain tissue, mouse cerebellum tissue
Positive IHC detected inmouse brain tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67503-1-Ig targets CDK5R1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.

Tested Reactivity Human, mouse, rat, pig, rabbit
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag13152

Product name: Recombinant human CDK5R1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 99-307 aa of BC020580

Sequence: AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR

Predict reactive species
Full Name cyclin-dependent kinase 5, regulatory subunit 1 (p35)
Calculated Molecular Weight 34 kDa
Observed Molecular Weight 34 kDa
GenBank Accession NumberBC020580
Gene Symbol CDK5R1
Gene ID (NCBI) 8851
RRIDAB_2882727
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ15078
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cyclin dependent kinase-5 (Cdk5), is an atypical but essential member of the Cdk family of proline-directed serine/threonine kinases. CDK5R1 encodes p35, a specific activator of the serine/threonine kinase CDK5, which plays a central role in neuronal migration and differentiation during central nervous system development. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form.

Protocols

Product Specific Protocols
IHC protocol for CDK5R1 antibody 67503-1-IgDownload protocol
WB protocol for CDK5R1 antibody 67503-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

CDK5R1 Monoclonal antibody (1A3A5), catalog number 67503-1-Ig, has 6 total citations published in Nature Communications, Acta Pharmaceutica Sinica B, Cancer Letters, Journal of Pharmaceutical Analysis, Science China Life Sciences, and Molecular Therapy Nucleic Acids. The research fields span lipid homeostasis and autophagy, redox homeostasis in breast cancer, ER-phagy in neuroblastoma, mitochondrial fission in colorectal cancer, microtubule deacetylation in glioblastoma, and tau hyperphosphorylation in Alzheimer's disease.

SpeciesApplicationTitle
humanIF

Nat Commun

GRAMD1B is a regulator of lipid homeostasis, autophagic flux and phosphorylated tau

Authors - Diana Acosta Ingram
humanWB

Acta Pharm Sin B

CDK5-triggered G6PD phosphorylation at threonine 91 facilitating redox homeostasis reveals a vulnerability in breast cancer

Authors - Yuncheng Bei
humanWB

Cancer Lett

CDK5RAP3 is a novel super-enhancer-driven gene activated by master TFs and regulates ER-Phagy in neuroblastoma

Authors - Ran Zhuo
humanWB,IF,CoIP

J Pharm Anal

Histone deacetylase inhibitor pracinostat suppresses colorectal cancer by inducing CDK5-Drp1 signaling-mediated peripheral mitofission

Authors - Xiao-Ling Liang
WB

Sci China Life Sci

FSD1 inhibits glioblastoma diffuse infiltration through restriction of HDAC6-mediated microtubule deacetylation

Authors - Dake Xiao
mouseIHC

Mol Ther Nucleic Acids

Implications of miR-148a-3p/p35/PTEN signaling in tau hyperphosphorylation and autoregulatory feedforward of Akt/CREB in Alzheimer's disease.

Authors - Li Zeng

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The single review for 67503-1-Ig is from Jia Kang Xie (September 2025), who used it for immunofluorescence with lot 10017101. They rated it 5 stars and reported that the antibody performed well, producing clear images under the microscope with no particular issues. Overall, the feedback is positive, highlighting reliable performance and good image quality in IF applications.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Jia Kang (Verified Customer) (09-05-2025)

The antibody worked rather well, providing clear images under the microscope. No particular issue with this specific antibody.

  • Applications: Immunofluorescence
Loading...
||
New chat

Able™

正在加载,请稍候...