Tested Applications
| Positive WB detected in | pig cerebellum tissue, pig brain tissue, rat brain tissue, mouse brain tissue, mouse cerebellum tissue |
| Positive IHC detected in | mouse brain tissue, rat brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67503-1-Ig targets CDK5R1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.
| Tested Reactivity | Human, mouse, rat, pig, rabbit |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG2b |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13152 Product name: Recombinant human CDK5R1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 99-307 aa of BC020580 Sequence: AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR Predict reactive species |
| Full Name | cyclin-dependent kinase 5, regulatory subunit 1 (p35) |
| Calculated Molecular Weight | 34 kDa |
| Observed Molecular Weight | 34 kDa |
| GenBank Accession Number | BC020580 |
| Gene Symbol | CDK5R1 |
| Gene ID (NCBI) | 8851 |
| RRID | AB_2882727 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q15078 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Cyclin dependent kinase-5 (Cdk5), is an atypical but essential member of the Cdk family of proline-directed serine/threonine kinases. CDK5R1 encodes p35, a specific activator of the serine/threonine kinase CDK5, which plays a central role in neuronal migration and differentiation during central nervous system development. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for CDK5R1 antibody 67503-1-Ig | Download protocol |
| WB protocol for CDK5R1 antibody 67503-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CDK5R1 Monoclonal antibody (1A3A5), catalog number 67503-1-Ig, has 6 total citations published in Nature Communications, Acta Pharmaceutica Sinica B, Cancer Letters, Journal of Pharmaceutical Analysis, Science China Life Sciences, and Molecular Therapy Nucleic Acids. The research fields span lipid homeostasis and autophagy, redox homeostasis in breast cancer, ER-phagy in neuroblastoma, mitochondrial fission in colorectal cancer, microtubule deacetylation in glioblastoma, and tau hyperphosphorylation in Alzheimer's disease.
| Species | Application | Title |
|---|---|---|
Nat Commun GRAMD1B is a regulator of lipid homeostasis, autophagic flux and phosphorylated tau | ||
Acta Pharm Sin B CDK5-triggered G6PD phosphorylation at threonine 91 facilitating redox homeostasis reveals a vulnerability in breast cancer | ||
Cancer Lett CDK5RAP3 is a novel super-enhancer-driven gene activated by master TFs and regulates ER-Phagy in neuroblastoma | ||
J Pharm Anal Histone deacetylase inhibitor pracinostat suppresses colorectal cancer by inducing CDK5-Drp1 signaling-mediated peripheral mitofission | ||
Sci China Life Sci FSD1 inhibits glioblastoma diffuse infiltration through restriction of HDAC6-mediated microtubule deacetylation | ||
Mol Ther Nucleic Acids Implications of miR-148a-3p/p35/PTEN signaling in tau hyperphosphorylation and autoregulatory feedforward of Akt/CREB in Alzheimer's disease. |
Reviews
What customers say
The single review for 67503-1-Ig is from Jia Kang Xie (September 2025), who used it for immunofluorescence with lot 10017101. They rated it 5 stars and reported that the antibody performed well, producing clear images under the microscope with no particular issues. Overall, the feedback is positive, highlighting reliable performance and good image quality in IF applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jia Kang (Verified Customer) (09-05-2025) | The antibody worked rather well, providing clear images under the microscope. No particular issue with this specific antibody.
|
