CDK5R1 Monoclonal antibody, PBS Only

• 

  WB analysis using 67503-1-Ig (same clone as 67503-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67503-1-Ig (CDK5R1 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated Alpha Tubulin Monoclonal antibody (HRP-66031) as loading control. This data was developed using the same antibody clone with 67503-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse cerebellum using 67503-1-Ig (same clone as 67503-1-PBS)

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 67503-1-Ig (CDK5R1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67503-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig brain using 67503-1-Ig (same clone as 67503-1-PBS)

  pig brain tissue were subjected to SDS PAGE followed by western blot with 67503-1-Ig (CDK5R1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67503-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat brain using 67503-1-Ig (same clone as 67503-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 67503-1-Ig (CDK5R1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67503-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 67503-1-Ig (same clone as 67503-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 67503-1-Ig (CDK5R1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67503-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67503-1-Ig (same clone as 67503-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67503-1-Ig (CDK5R1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67503-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 67503-1-Ig (same clone as 67503-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67503-1-Ig (CDK5R1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67503-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 67503-1-Ig (same clone as 67503-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67503-1-Ig (CDK5R1 antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67503-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 67503-1-Ig (same clone as 67503-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 67503-1-Ig (CDK5R1 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67503-1-PBS in a different storage buffer formulation.

CDK5R1 Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 67503-1-PBS

Clone No.1A3A5

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat, pig, rabbit

Applications

WB, IHC, Indirect ELISA

Synonyms

CDK5 activator 1, CDK5P35, CDK5R, CDK5R1, NCK5A, p23, p25, p35, p35nck5a, TPKII regulatory subunit

---

Product Information

67503-1-PBS targets CDK5R1 in WB, IHC, Indirect ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples.

• Tested Reactivity: Human, mouse, rat, pig, rabbit
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13152

  Product name: Recombinant human CDK5R1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 99-307 aa of BC020580

  Sequence: AQPPPAQPPAPPASQLSGSQTGGSSSVKKAPHPAVTSAGTPKRVIVQASTSELLRCLGEFLCRRCYRLKHLSPTDPVLWLRSVDRSLLLQGWQDQGFITPANVVFLYMLCRDVISSEVGSDHELQAVLLTCLYLSYSYMGNEISYPLKPFLVESCKEAFWDRCLSVINLMSSKMLQINADPHYFTQVFSDLKNESGQEDKKRLLLGLDR

• Full Name: cyclin-dependent kinase 5, regulatory subunit 1 (p35)
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC020580
• Gene Symbol: CDK5R1
• Gene ID (NCBI): 8851
• RRID: AB_2882727
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15078
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cyclin dependent kinase-5 (Cdk5), is an atypical but essential member of the Cdk family of proline-directed serine/threonine kinases. CDK5R1 encodes p35, a specific activator of the serine/threonine kinase CDK5, which plays a central role in neuronal migration and differentiation during central nervous system development. The p35 form of this protein is proteolytically cleaved by calpain, generating a p25 form.