CDK5R2/p39 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CDK5R2/p39 Polyclonal antibody, PBS Only (27058-1-PBS)

• 

  WB analysis of Neuro-2a using 27058-1-AP (same clone as 27058-1-PBS)

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 27058-1-AP (CDK5R2/p39 antibody at dilution of 1:600 incubated at 4 degree celsius over night. This data was developed using the same antibody clone with 27058-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 27058-1-AP (same clone as 27058-1-PBS)

  various lysates were subjected to SDS PAGE followed by western blot with 27058-1-AP (CDK5R2/p39 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27058-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27058-1-AP (same clone as 27058-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27058-1-AP (CDK5R2/p39 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27058-1-PBS in a different storage buffer formulation.

CDK5R2/p39 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 27058-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

27058-1-PBS targets CDK5R2/p39 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25834

  Product name: Recombinant human CDK5R2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 9-75 aa of BC041771

  Sequence: PASSAKGRRPGGLPEEKKKAPPAGDEALGGYGAPPVGKGGKGESRLKRPSVLISALTWRRLVAASAK

• Full Name: cyclin-dependent kinase 5, regulatory subunit 2 (p39)
• Observed Molecular Weight: 39 kDa
• GenBank Accession Number: BC041771
• Gene Symbol: CDK5R2/p39
• Gene ID (NCBI): 8941
• RRID: AB_2880735
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13319
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CDK5R2 is a neuron-specific activator of CDK5 kinase. It associates with CDK5 to form an active kinase. This protein and neuron-specific CDK5 activator CDK5R1/p39NCK5A both share limited similarity to cyclins, and thus may define a distinct family of cyclin-dependent kinase activating proteins.