CDK6 Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CDK6 Monoclonal antibody (66278-1-Ig)

• Featured Product
• KD/KO Validated

CDK6 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66278-1-Ig Copied!

Clone No. 4B9C11

Publications (30)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA
For FC, select conjugated version.

Synonyms

4B9C11, CDKN6, Cell division protein kinase 6, Cyclin dependent kinase 6, Cyclin-dependent kinase 6

• 

  WB analysis using 66278-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66278-1-Ig (CDK6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 66278-1-Ig

  WB result of CDK6 antibody (66278-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CDK6 transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of THP-1 using 66278-1-Ig

  THP-1 cells were subjected to SDS PAGE followed by western blot with 66278-1-Ig (CDK6 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Jurkat using 66278-1-Ig

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66278-1-Ig (CDK6 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 66278-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66278-1-Ig (CDK6 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 66278-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 66278-1-Ig (CDK6 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skin cancer using 66278-1-Ig

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 66278-1-Ig (CDK6 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 66278-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CDK6 antibody (66278-1-Ig, Clone: 4B9C11 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of MOLT-4 using 66278-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed MOLT-4 cells using CDK6 antibody (66278-1-Ig, Clone: 4B9C11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CDK6 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, Jurkat cells, NIH/3T3 cells, ROS1728 cells, THP-1 cells, HepG2 cells, K-562 cells, HSC-T6 cells, C6 cells, Raw 264.7 cells
• Positive IHC detected in: human skin cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MOLT-4 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66278-1-Ig targets CDK6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5600

  Product name: Recombinant human CDK6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-326 aa of BC027989

  Sequence: MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

• Full Name: cyclin-dependent kinase 6
• Calculated Molecular Weight: 326 aa, 36 kDa
• Observed Molecular Weight: 36-40 kDa
• GenBank Accession Number: BC027989
• Gene Symbol: CDK6
• Gene ID (NCBI): 1021
• RRID: AB_2881661
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q00534
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDK6(Cyclin-dependent kinase 6) is involved in initiation and maintenance of cell cycle exit during cell differentiation and it prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types.The molecular weight of CDK6 is 36-40 KDa (PMID: 23563707, 8114739). 

Publications

What published studies show

CDK6 Monoclonal antibody (4B9C11), catalog number 66278-1-Ig, has accumulated 30 citations across journals including Nature Cancer, Nature Communications, Phytomedicine, Cell Death Discovery, Cell Signaling, International Journal of Molecular Sciences, iScience, European Journal of Medicinal Chemistry, and others. The associated research fields primarily span oncology (breast, lung, prostate, pancreatic, gastric, colorectal, and other cancers), cell cycle regulation, antitumor immunity, natural product pharmacology, targeted protein degradation, and cardiotoxicity.

Automatically generated from the 30 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Nat Cancer; CDK10 suppresses nucleic acid sensors-mediated antitumor immunity; Authors - Gaoshan Xu
human	WB,IF	Nat Commun; DNA framework-engineered chimeras platform enables selectively targeted protein degradation; Authors - Li Zhou
human	WB	Phytomedicine; Ethyl acetate extract of Antenoron Filiforme inhibits the proliferation of triple negative breast cancer cells via suppressing Skp2/p21 signaling axis; Authors - Yile Liao
human	WB	Phytomedicine; Transcriptomics and molecular docking reveal the potential mechanism of lycorine against pancreatic cancer; Authors - Xin Zhou
human	WB	Cell Death Discov; Paired box 8 facilitates the c-MYC related cell cycle progress in TP53-mutation uterine corpus endometrial carcinoma through interaction with DDX5.; Authors - Ping Qiu
human		Chin J Nat Med; Talaketides A-G, linear polyketides with prostate cancer cytotoxic activity from the mangrove sediment-derived fungus Talaromyces sp. SCSIO 41027; Authors - Chunmei Chen