CDK6 Monoclonal antibody, PBS Only

• 

  WB analysis using 66278-1-Ig (same clone as 66278-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66278-1-Ig (CDK6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66278-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66278-1-Ig (same clone as 66278-1-PBS)

  WB result of CDK6 antibody (66278-1-Ig; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CDK6 transfected HEK-293 cells. This data was developed using the same antibody clone with 66278-1-PBS in a different storage buffer formulation.

• 

  WB analysis of THP-1 using 66278-1-Ig (same clone as 66278-1-PBS)

  THP-1 cells were subjected to SDS PAGE followed by western blot with 66278-1-Ig (CDK6 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66278-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 66278-1-Ig (same clone as 66278-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 66278-1-Ig (CDK6 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66278-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66278-1-Ig (same clone as 66278-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66278-1-Ig (CDK6 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66278-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66278-1-Ig (same clone as 66278-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66278-1-Ig (CDK6 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66278-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 66278-1-Ig (same clone as 66278-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 66278-1-Ig (CDK6 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66278-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MOLT-4 using 66278-1-Ig (same clone as 66278-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed MOLT-4 cells using CDK6 antibody (66278-1-Ig, Clone: 4B9C11 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L) (SA00013-1). This data was developed using the same antibody clone with 66278-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CDK6 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66278-1-PBS

Clone No.4B9C11

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

4B9C11, CDKN6, Cell division protein kinase 6, Cyclin dependent kinase 6, Cyclin-dependent kinase 6

---

Product Information

66278-1-PBS targets CDK6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5600

  Product name: Recombinant human CDK6 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-326 aa of BC027989

  Sequence: MEKDGLCRADQQYECVAEIGEGAYGKVFKARDLKNGGRFVALKRVRVQTGEEGMPLSTIREVAVLRHLETFEHPNVVRLFDVCTVSRTDRETKLTLVFEHVDQDLTTYLDKVPEPGVPTETIKDMMFQLLRGLDFLHSHRVVHRDLKPQNILVTSSGQIKLADFGLARIYSFQMALTSVVVTLWYRAPEVLLQSSYATPVDLWSVGCIFAEMFRRKPLFRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELNTA

• Full Name: cyclin-dependent kinase 6
• Calculated Molecular Weight: 326 aa, 36 kDa
• Observed Molecular Weight: 36-40 kDa
• GenBank Accession Number: BC027989
• Gene Symbol: CDK6
• Gene ID (NCBI): 1021
• RRID: AB_2881661
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q00534
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CDK6(Cyclin-dependent kinase 6) is involved in initiation and maintenance of cell cycle exit during cell differentiation and it prevents cell proliferation and regulates negatively cell differentiation, but is required for the proliferation of specific cell types.The molecular weight of CDK6 is 36-40 KDa (PMID: 23563707, 8114739).