CDR2L Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CDR2L Monoclonal antibody (66791-1-Ig)

• Featured Product
• KD/KO Validated

CDR2L Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66791-1-Ig Copied!

Clone No. 2E12D10

Publications (2)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

Human, Mouse, Rat and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

CDR2L, HUMPPA, Paraneoplastic 62 kDa antigen

• 

  WB analysis of U-251 using 66791-1-Ig

  U-251 cells were subjected to SDS PAGE followed by western blot with 66791-1-Ig (CDR2L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of rat brain using 66791-1-Ig

  rat brain tissue were subjected to SDS PAGE followed by western blot with 66791-1-Ig (CDR2L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 66791-1-Ig

  WB result of CDR2L antibody (66791-1-Ig; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CDR2L transfected HEK-293 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 66791-1-Ig

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 66791-1-Ig (CDR2L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 66791-1-Ig

  K-562 cells were subjected to SDS PAGE followed by western blot with 66791-1-Ig (CDR2L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 66791-1-Ig

  human brain tissue were subjected to SDS PAGE followed by western blot with 66791-1-Ig (CDR2L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 66791-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66791-1-Ig (CDR2L antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cerebellum using 66791-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 66791-1-Ig (CDR2L antibody) at dilution of 1:400 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cerebellum using 66791-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cerebellum tissue slide using 66791-1-Ig (CDR2L antibody) at dilution of 1:400 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 66791-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using CDR2L antibody (66791-1-Ig, Clone: 2E12D10 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CDR2L in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: U-251 cells, HEK-293 cells, K-562 cells, human brain tissue, rat brain tissue, mouse brain tissue
• Positive IHC detected in: human cerebellum tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

66791-1-Ig targets CDR2L in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with Human, Mouse, Rat samples.

• Tested Reactivity: Human, Mouse, Rat
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6139

  Product name: Recombinant human CDR2L protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 110-459 aa of BC047534

  Sequence: TETIERLQAQVEELQAQVEQLRGLEQLRVLREKRERRRTIHTFPCLKELCTSPRCKDAFRLHSSSLELGPRPLEQENERLQTLVGALRSQVSQERQRKERAEREYTAVLQEYSELERQLCEMEACRLRVQELEAELLELQQMKQAKTYLLGPDDHLAEALLAPLTQAPEADDPQPGRGDDLGAQDGVSSPAASPGHVVRKSCSDTALNAIVAKDPASRHAGNLTLHANSVRKRGMSILREVDEQYHALLEKYEELLSKCRQHGAGVRHAGVQTSRPISRDSSWRDLRGGEEGQGEVKAGEKSLSQHVEAVDKRLEQSQPEYKALFKEIFSRIQKTKADINATKVKTHSSK

• Full Name: cerebellar degeneration-related protein 2-like
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC047534
• Gene Symbol: CDR2L
• Gene ID (NCBI): 30850
• RRID: AB_2882135
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q86X02
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cerebellar degeneration-related protein 2-like(CDR2L), also named as HUMPPA or Paraneoplastic 62 kDa antigen, is a 465 amino acid protein, which belongs to the CDR2 family. CDR2L contains three potential coiled-coil regions. The functions of protein is so far not known. CDR2L is expressed in the brain and localizes in the cytoplasm.

Publications

What published studies show

The CDR2L Monoclonal antibody (2E12D10), catalog number 66791-1-Ig, has 2 total citations. These appear in Annals of Clinical and Translational Neurology and Surgical Case Reports. The associated research fields include paraneoplastic cerebellar degeneration and anti-Yo antibody-associated paraneoplastic neurological syndrome in breast cancer. The cited application is immunoprecipitation (IP) in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IP	Ann Clin Transl Neurol; Localization of CDR2L and CDR2 in paraneoplastic cerebellar degeneration.; Authors - Ida Herdlevaer
		Surg Case Rep; Breast Cancer with Subacute Progressive Neurological Symptoms due to Anti-Yo Antibody-Associated Paraneoplastic Neurological Syndrome: A Case Report.; Authors - Moe Tasaki