CDX2 Polyclonal antibody

CDX2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 22101-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

caudal type homeobox 2, Caudal type homeobox protein 2, CDX 3, CDX2, CDX3, Homeobox protein CDX 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCOLO 320 cells, Caco-2 cells, mouse colon tissue, mouse brain tissue
Positive IHC detected inmouse small intestine tissue, human appendicitis tissue, human stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inCaco-2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22101-1-AP targets CDX2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17310

Product name: Recombinant human CDX2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-180 aa of BC014461

Sequence: MYVSYLLDKDVSMYPSSVRHSGGLNLAPQNFVSPPQYPDYGGYHVAAAAAAAANLDSAQSPGPSWPAAYGAPLREDWNGYAPGGAAAAANAVAHGLNGGSPAAAMGYSSPADYHPHHHPHHHPHHPAAAPSCASGLLQTLNPGPPGPAATAAAEQLSPGGQRRNLCEWMRKPAQQSLGSQ

Predict reactive species
Full Name caudal type homeobox 2
Calculated Molecular Weight 313 aa, 34 kDa
Observed Molecular Weight 33-40 kDa
GenBank Accession NumberBC014461
Gene Symbol CDX2
Gene ID (NCBI) 1045
RRIDAB_3085684
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ99626
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CDX2, also named as Homeobox protein CDX-2, is a 313 amino acid protein, which contains one homeobox DNA-binding domain and belongs to the Caudal homeobox family. CDX2 localizes in the nucleus and is involved in the transcriptional regulation of multiple genes expression in the intestinal epithelium. The relative expression of CDX1 to CDX2 protein may be important in the anterior to posterior patterning of the intestinal epithelium and in defining patterns of proliferation and differentiation along the crypt-villus axis. Both Cdx1 and Cdx2 genes must be expressed to reduce tumorigenic potential, to increase sensitivity to apoptosis, and to reduce cell migration, suggesting that the two genes control the normal phenotype by independent pathways.

Protocols

Product Specific Protocols
IF protocol for CDX2 antibody 22101-1-APDownload protocol
IHC protocol for CDX2 antibody 22101-1-APDownload protocol
WB protocol for CDX2 antibody 22101-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...