CEA/CD66e Monoclonal antibody

• Home
• Products
• Primary Antibodies
• CEA/CD66e Monoclonal antibody (68377-1-Ig)

CEA/CD66e Monoclonal Antibody for WB, IHC, IHC-Autostainer, ELISA

Cat No. 68377-1-Ig Copied!

Clone No. 2B8H6

Publications (3)

Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human

Applications

WB, IHC, IHC-Autostainer, ELISA

Synonyms

CEA, 2B8H6, Carcinoembryonic antigen, Carcinoembryonic antigen-related cell adhesion molecule 5, CD66e

• 

  WB analysis using 68377-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68377-1-Ig (CEA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 68377-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68377-1-Ig (CEA antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 68377-1-Ig (CEA/CD66e antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human large intestine using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human large intestine tissue slide using 68377-1-Ig (CEA/CD66e antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 68377-1-Ig (CEA/CD66e antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 68377-1-Ig (CEA/CD66e antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colorectal cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colorectal cancer tissue slide using 68377-1-Ig (CEA/CD66e antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68377-1-Ig (CEA/CD66e antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). The staining was performed on an autostainer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 68377-1-Ig (CEACAM5 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 68377-1-Ig (CEACAM5 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 68377-1-Ig (CEA antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 68377-1-Ig (CEA antibody) at dilution of 1:2000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 68377-1-Ig (CEA antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 68377-1-Ig (CEA antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 68377-1-Ig (CEA antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human lung using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 68377-1-Ig (CEA antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 68377-1-Ig (CEA/CD66e antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 68377-1-Ig (CEA/CD66e antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68377-1-Ig (CEA/CD66e antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 68377-1-Ig (CEA/CD66e antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human large intestine using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human large intestine tissue slide using 68377-1-Ig (CEA/CD66e antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colorectal cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colorectal cancer tissue slide using 68377-1-Ig (CEA/CD66e antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer tissue slide using 68377-1-Ig (CEA/CD66e antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human appendicitis using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human appendicitis tissue slide using 68377-1-Ig (CEA/CD66e antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 68377-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68377-1-Ig (CEA/CD66e antibody) at dilution of 1:2000. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CEA/CD66e in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HaCaT cells, human saliva, HT-29 cells, human rectum tissue
• Positive IHC-Autostainer detected in: human pancreas cancer tissue, human cervical cancer tissue, human colorectal cancer tissue, human large intestine tissue, human stomach cancer tissue, human appendicitis tissue
• Positive IHC detected in: human colon cancer tissue, human pancreas cancer tissue, human appendicitis tissue, human stomach cancer tissue, human cervical cancer tissue, human colorectal cancer tissue, human pancreas tissue, human large intestine tissue, human lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC)-AUTOSTAINER: IHC-AUTOSTAINER : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:2500-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68377-1-Ig targets CEA/CD66e in WB, IHC, IHC-Autostainer, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg0247

  Product name: Recombinant Human CEA/CD66e protein (hFc Tag)

  Source: mammalian cells-derived, pINFUSE-IGSF8-CFc2(A2)

  Tag: C-hIGg2fc

  Domain: 35-685 aa of BC034671

  Sequence: KLTIESTPFNVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNRQIIGYVIGTQQATPGPAYSGREIIYPNASLLIQNIIQNDTGFYTLHVIKSDLVNEEATGQFRVYPELPKPSISSNNSKPVEDKDAVAFTCEPETQDATYLWWVNNQSLPVSPRLQLSNGNRTLTLFNVTRNDSASYKCETQNPVSARRSDSVILNVLYGPDAPTISPLNTSYRSGENLNLSCHAASNPPAQYSWFVNGTFQQSTQELFIPNITVNNSGSYTCQAHNSDTGLNRTTVTTITVYAEPPKPFITSNNSNPVEDEDAVALTCEPEIQNTTYLWWVNNQSLPVSPRLQLSNDNRTLTLLSVTRNDVGPYECGIQNELSVDHSDPVILNVLYGPDDPTISPSYTYYRPGVNLSLSCHAASNPPAQYSWLIDGNIQQHTQELFISNITEKNSGLYTCQANNSASGHSRTTVKTITVSAELPKPSISSNNSKPVEDKDAVAFTCEPEAQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLFNVTRNDARAYVCGIQNSVSANRSDPVTLDVLYGPDTPIISPPDSSYLSGANLNLSCHSASNPSPQYSWRINGIPQQHTQVLFIAKITPNNNGTYACFVSNLATGRNNSIVKSITVSASGTSPGLSA

• Full Name: carcinoembryonic antigen-related cell adhesion molecule 5
• Calculated Molecular Weight: 77 kDa
• Observed Molecular Weight: 180-200 kDa
• GenBank Accession Number: BC034671
• Gene Symbol: CEA
• Gene ID (NCBI): 1048
• RRID: AB_3085095
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P06731
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Carcinoembryonic antigen (CEA), also known as CEACAM5 or CD66e, is a cell surface glycoprotein belonging to the immunoglobulin superfamily, mainly serving as a cell adhesion molecule mediating intercellular contact by both homophilic and heterophilic binding (PMID: 21731662). CEA inhibits anoikis and plays a role in tumorigenesis and metastasis. CEA has been found to be overexpressed in a wide variety of human cancers, including colon, breast, and lung (PMID: 17167768). CEA is a tumor marker and is routinely exploited for diagnosis.

Publications

What published studies show

The CEA/CD66e Monoclonal antibody (2B8H6), catalog number 68377-1-Ig, has 3 total citations. These appear in Biomark Res, Cancer Lett, and BMC Cancer. The associated research fields include gastric cancer (histone modification-regulated lncRNA and DNA repair), CEACAM5-positive tumor targeting via antibody-drug conjugates, and cholangiocarcinoma (organoid-based drug screening). All citations involve human samples, with applications in IHC and WB.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Biomark Res; Histone modification-regulated LncRNA DLEU1 interacts with ASCC2/ALKBH3 complex to drive DNA repair, antioxidant homeostasis and glucose metabolism in gastric cancer.; Authors - Xiaoyan Zhang
human	WB	Cancer Lett; A High-Affinity Antibody-Drug Conjugates Actuximab-MMAE for Potent and Selective Targeting of CEACAM5-Positive Tumors; Authors - Yuqi Hu
human	IHC	BMC Cancer; Individualized drug screening in cholangiocarcinoma using organoid models and patient-derived tumor xenograft.; Authors - Pinsheng Han