CEACAM21 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CEACAM21 Polyclonal antibody, PBS Only (17209-1-PBS)

• 

  WB analysis using 17209-1-AP (same clone as 17209-1-PBS)

  Mouse liver tissue lysate was subjected to SDS PAGE followed by western blot with 17209-1-AP (CEACAM21 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17209-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 17209-1-AP (same clone as 17209-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 17209-1-AP (CEACAM21 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17209-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human placenta using 17209-1-AP (same clone as 17209-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 17209-1-AP (CEACAM21 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17209-1-PBS in a different storage buffer formulation.

CEACAM21 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 17209-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

Carcinoembryonic antigen-related cell adhesion molecule 21, UNQ3098/PRO10075

---

Product Information

17209-1-PBS targets CEACAM21 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10992

  Product name: Recombinant human CEACAM21 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-191 aa of BC012001

  Sequence: MGPPSACPHRECIPWQGLLLTASLLTFWNAPTTAWLFIASAPFEVAEGENVHLSVVYLPENLYSYGWYKGKTVEPNQLIAAYVIDTHVRTPGPAYSGRETISPSGDLHFQNVTLEDTGYYNLQVTYRNSQIEQASHHLRVYGECSKFDSEISEDAAWPQDTFCWSLYPQSQWLSPPSKPAAPQSQRRAPWS

• Full Name: carcinoembryonic antigen-related cell adhesion molecule 21
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC012001
• Gene Symbol: CEACAM21
• Gene ID (NCBI): 90273
• RRID: AB_2077481
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q3KPI0
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Carcinoembryonic antigen-related cell adhesion molecule 21 (CEACAM21) is a member of the CEACAM family that has diverse functions in cell adhesion, in intracellular and intercellular signaling, and during complex biological processes such as cancer progression, inflammation, angiogenesis, and metastasis (PMID: 23903773; 32488569). CEACAM21 acts as a heterophilic ligand for TIM-3, leading to the dissociation of Bat3 and increasing proximal TCR signaling and proapoptotic protein expression in late effector T cells, thereby mediating T cell suppression (PMID: 38490257).