FITC Plus Anti-Human CEACAM6/CD66c Rabbit Recombinant Antibody

• Home
• Products
• Primary Antibodies
• Flow Cytometry Antibodies
• FITC Plus Anti-Human CEACAM6/CD66c Rabbit Recombinant Antibody (FITC-98329-3)

CEACAM6/CD66c Uni-rAb^® Recombinant Antibody for FC

Cat No. FITC-98329-3 Copied!

Clone No. 241997G1

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CEACAM6, 241997G1, Carcinoembryonic antigen-related cell adhesion molecule 6, CD66c, CEAL

• 

  FC experiment of human peripheral blood leukocytes using FITC-98329-3

  1x10^6 human peripheral blood leukocytes were surface stained with 5 ul FITC Plus Anti-Human CEACAM6/CD66c Rabbit RecAb (FITC-98329-3, Clone: 241997G1) or FITC Plus Rabbit IgG Isotype Control RecAb (FITC-98136, Clone: 240953C9) . Cells were incubated with FC Receptor Block prior to fixing and staining. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of human peripheral blood leukocytes using FITC-98329-3

  1x10^6 human peripheral blood leukocytes were surface stained with 5 ul FITC Plus Anti-Human CEACAM6/CD66c Rabbit RecAb (FITC-98329-3, Clone: 241997G1) (red) or FITC Plus Rabbit IgG Isotype Control RecAb (FITC-98136, Clone: 240953C9) (blue). Cells were incubated with FC Receptor Block prior to fixing and staining. Cells were not fixed.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for CEACAM6/CD66c in ?

Chat with Able

---

Tested Applications

• Positive FC detected in: human peripheral blood leukocytes

Recommended dilution

• Flow Cytometry (FC): FC : 5 ul per 10^6 cells in a 100 µl suspension

This reagent has been pre-titrated and tested for flow cytometric analysis. The suggested use of this reagent is 5 ul per 10^6 cells in a 100 µl suspension or 5 ul per 100 µl of whole blood.

Sample-dependent, Check data in validation data gallery.

Product Information

FITC-98329-3 targets CEACAM6/CD66c in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg2450

  Product name: recombinant human CEACAM6 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 35-320 aa of BC005008

  Sequence: KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVYPELPKPSISSNNSNPVEDKDAVAFTCEPEVQNTTYLWWVNGQSLPVSPRLQLSNGNMTLTLLSVKRNDAGSYECEIQNPASANRSDPVTLNVLYGPDVPTISPSKANYRPGENLNLSCHAASNPPAQYSWFINGTFQQSTQELFIPNITVNNSGSYMCQAHNSATGLNRTTVTMITVSG

• Full Name: carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen)
• Calculated Molecular Weight: 37 kDa
• GenBank Accession Number: BC005008
• Gene Symbol: CEACAM6
• Gene ID (NCBI): 4680
• RRID: AB_3749463
• Conjugate: FITC Plus Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 495 nm / 524 nm
• Excitation Laser: Blue laser (488 nm)
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P40199
• Storage Buffer: PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Carcinoembryonic antigen-related cell adhesion molecules (CEACAMs) belong to the immunoglobulin superfamily of cell adhesion molecules. CEACAMs play major roles in cell-cell and cell-ECM adhesion and have been implicated in controlling cell proliferation, angiogenesis, and tissue remodeling (PMID: 23021083). CEACAM6, also known as CD66c, is a glycosylphosphatidylinositol (GPI)-linked cell surface protein that belongs to the CEACAM family of the immunoglobulin superfamily (PMID: 23903773). It is normally expressed on the surface of myeloid and epithelial surfaces and upregulated preferentially at the apical/luminal membranes of many tumors (PMID: 27595061; 35082925). CEACAM6 plays an important role in cell adhesion, proliferation, tumorigenesis, metastasis, and immunity (PMID: 31797958).