Anti-Human CEACAM5/8 (CD66b/e) Rabbit Recombinant Antibody

• 

  FC experiment of human peripheral blood leukocytes using 98012-1-RR

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Anti-Human CEACAM5/8 (CD66b/e) Rabbit Recombinant Antibody (98012-1-RR, Clone:230353B7) or 0.25 ug Isotype Control, and PE-conjugated Goat Anti-Rabbit IgG. Cells were not fixed.

• 

  Affinity and Kinetic Characterization of 98012-1-RR

  Biolayer interferometry (BLl) kinetic assays of 98012-1-RR against Human CEACAM5/8 (CD66b/e) were performed. The affinity constant is 2.31 nM.

CEACAM5/8 (CD66b/e) Uni-rAb^® Recombinant Antibody for FC

Cat No. 98012-1-RR

Clone No.230353B7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD66e, CEACAM5, CEACAM5/CD66e, CEACAM8/CD66b, CD66b

---

Tested Applications

• Positive FC detected in: human peripheral blood leukocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in 100 μl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

98012-1-RR targets CEACAM5/8 (CD66b/e) in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg32133

  Product name: Recombinant Human CEACAM-8 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 35-319 aa of BC026263

  Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS

• Full Name: CEACAM5/8 (CD66b/e)
• RRID: AB_3672154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P31997
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Stable for one year after shipment.

Background Information

Carcinoembryonic antigen-related cell adhesion molecules (CEACAMs) belong to the immunoglobulin superfamily of cell adhesion molecules. CEACAMs play major roles in cell-cell and cell-ECM adhesion and have been implicated in controlling cell proliferation, angiogenesis, and tissue remodeling (PMID: 23021083). Carcinoembryonic antigen (CEA), also known as CEACAM5 or CD66e mainly serves as a cell adhesion molecule mediating intercellular contact by both homophilic and heterophilic binding (PMID: 21731662). CEACAM8, also known as CD66b, CGM6 or NCA-95, is a glycosylphosphatidylinositol (GPI)-linked glycoprotein expressed on granulocytes and is involved in regulating adhesion and activation of eosinophils (PMID: 8104998; 18056392; 18056392). This antibody is raised against 35-319 aa of human CEACAM8/CD66b and can cross-react with CEACAM5/CD66e.