Biotin Anti-Human CEACAM5/8 (CD66b/e) Rabbit Recombinant Antibody

• 

  FC experiment of human peripheral blood leukocytes using Biotin-98012

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Biotin Anti-Human CEACAM5/8 (CD66b/e) Rabbit RecAb (Biotin-98012, Clone: 230353B7) or Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-98136, Clone: 240953C9), and Streptavidin-PE Conjugate (PE-PF00030). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

• 

  FC experiment of human peripheral blood leukocytes using Biotin-98012

  1x10^6 human peripheral blood leukocytes were surface stained with 0.25 ug Biotin Anti-Human CEACAM5/8 (CD66b/e) Rabbit RecAb (Biotin-98012, Clone: 230353B7) or Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-98136, Clone: 240953C9), and Streptavidin-PE Conjugate (PE-PF00030). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed.

CEACAM5/8 (CD66b/e) Uni-rAb^® Recombinant Antibody for FC

Cat No. Biotin-98012

Clone No.230353B7

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD66e, CEACAM5, CEACAM5/CD66e, CEACAM8/CD66b, CD66b

---

Tested Applications

• Positive FC detected in: human peripheral blood leukocytes

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-98012 targets CEACAM5/8 (CD66b/e) in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg32133

  Product name: Recombinant Human CEACAM-8 protein (Myc Tag, His Tag)

  Source: mammalian cells-derived, pHZ-KIsec

  Tag: Myc & 6*His

  Domain: 35-319 aa of BC026263

  Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVS

• Full Name: CEACAM5/8 (CD66b/e)
• Gene ID (NCBI): 1088
• Conjugate: Biotin
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P31997
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Carcinoembryonic antigen-related cell adhesion molecules (CEACAMs) belong to the immunoglobulin superfamily of cell adhesion molecules. CEACAMs play major roles in cell-cell and cell-ECM adhesion and have been implicated in controlling cell proliferation, angiogenesis, and tissue remodeling (PMID: 23021083). Carcinoembryonic antigen (CEA), also known as CEACAM5 or CD66e mainly serves as a cell adhesion molecule mediating intercellular contact by both homophilic and heterophilic binding (PMID: 21731662). CEACAM8, also known as CD66b, CGM6 or NCA-95, is a glycosylphosphatidylinositol (GPI)-linked glycoprotein expressed on granulocytes and is involved in regulating adhesion and activation of eosinophils (PMID: 8104998; 18056392; 18056392). This antibody is raised against 35-319 aa of human CEACAM8/CD66b and can cross-react with CEACAM5/CD66e.