CEBPE Polyclonal antibody

• 

  WB analysis of mouse liver using 14271-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 14271-1-AP (CEBPE Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 14271-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 14271-1-AP (CEBPE Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 14271-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 14271-1-AP (CEBPE antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

CEBPE Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 14271-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

CRP1, CCAAT/enhancer-binding protein epsilon, C/EBP epsilon

---

Tested Applications

• Positive WB detected in: mouse liver tissue, U-937 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

14271-1-AP targets CEBPE in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5589

  Product name: Recombinant human CEBPE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-281 aa of BC035797

  Sequence: MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS

• Full Name: CCAAT/enhancer binding protein (C/EBP), epsilon
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC035797
• Gene Symbol: CEBPE
• Gene ID (NCBI): 1053
• RRID: AB_2878038
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15744
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Ann N Y Acad Sci; LncRNA-ES3 inhibition by Bhlhe40 is involved in high glucose-induced calcification/senescence of vascular smooth muscle cells.; Authors - Jia-Yu Zhong