CEBPE Recombinant monoclonal antibody

• 

  WB analysis of HL-60 using 86432-1-RR

  HL-60 cells were subjected to SDS PAGE followed by western blot with 86432-1-RR (CEBPE antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 86432-1-RR

  Jurkat cells were subjected to SDS PAGE followed by western blot with 86432-1-RR (CEBPE antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 86432-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CEBPE antibody (86432-1-RR, Clone: 251303B10 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of HeLa using 86432-1-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using CEBPE antibody (86432-1-RR, Clone: 251303B10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  IF Staining of A431 using 86432-1-RR

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CEBPE antibody (86432-1-RR, Clone: 251303B10 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

CEBPE Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 86432-1-RR

Clone No.251303B10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

C/EBP epsilon, CCAAT/enhancer-binding protein epsilon, CRP1

---

Tested Applications

• Positive WB detected in: Jurkat cells, HL-60 cells
• Positive IF/ICC detected in: HepG2 cells, A431 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

86432-1-RR targets CEBPE in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5589

  Product name: Recombinant human CEBPE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-281 aa of BC035797

  Sequence: MSHGTYYECEPRGGQQPLEFSGGRAGPGELGDMCEHEASIDLSAYIESGEEQLLSDLFAVKPAPEARGLKGPGTPAFPHYLPPDPRPFAYPPHTFGPDRKALGPGIYSSPGSYDPRAVAVKEEPRGPEGSRAASRGSYNPLQYQVAHCGQTAMHLPPTLAAPGQPLRVLKAPLATAAPPCSPLLKAPSPAGPLHKGKKAVNKDSLEYRLRRERNNIAVRKSRDKAKRRILETQQKVLEYMAENERLRSRVEQLTQELDTLRNLFRQIPEAANLIKGVGGCS

• Full Name: CCAAT/enhancer binding protein (C/EBP), epsilon
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 31-38 kDa
• GenBank Accession Number: BC035797
• Gene Symbol: CEBPE
• Gene ID (NCBI): 1053
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q15744
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CEBPE (CCAAT/enhancer binding protein epsilon), also known as C/EBP-epsilon and CRP1, is a transcription factor involved in late myeloid lineage differentiation and cellular function (PMID: 31201888). CEBPE is expressed in a stage-specific manner during myeloid differentiation and regulates transition from the promyelocyte to the myelocyte (PMID: 29773596). Depletion of CEBPE in Acute lymphoblastic leukaemia (ALL) cells reduces cell growth, correspondingly CEBPE binds to the promoters of electron transport and energy generation genes (PMID: 29977016).