CEL Recombinant monoclonal antibody

• 

  WB analysis using 85081-4-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85081-4-RR (CEL antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human pancreas using 85081-4-RR

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 85081-4-RR (CEL antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas using 85081-4-RR

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 85081-4-RR (CEL antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 85081-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85081-4-RR against Human CEL were performed. The affinity constant is 2.46 nM.

CEL Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 85081-4-RR

Clone No.242761B11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

Bile salt-activated lipase, 242761B11, BAL, Bile salt-stimulated lipase, BSDL

---

Tested Applications

• Positive WB detected in: HeLa cells, MCF-7 cells, Raji cells
• Positive IHC detected in: human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85081-4-RR targets CEL in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag5262

  Product name: Recombinant human CEL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 371-722 aa of BC042510

  Sequence: SEFTITKGLRGAKTTFDVYTESWAQDPSQENKKKTVVDFETDVLFLVPTEIALAQHRANAKSAKTYAYLFSHPSRMPVYPKWVGADHADDIQYVFGKPFATPTGYRPQDRTVSKAMIAYWTNFAKTGDPNMGDSAVPTHWEPYTTENSGYLEITKKMGSSSMKRSLRTNFLRYWTLTYLALPTVTDQEATPVPPTGDSEATPVPPTGDSETAPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDSGAPPVPPTGDAGPPPVPPTGDSGAPPVPPTGDSGAPPVTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIRF

• Full Name: carboxyl ester lipase (bile salt-stimulated lipase)
• Calculated Molecular Weight: 79 kDa
• Observed Molecular Weight: 79 kDa
• GenBank Accession Number: BC042510
• Gene Symbol: CEL
• Gene ID (NCBI): 1056
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P19835
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Bile salt-activated lipase, previously named cholesterol esterase or bile salt-stimulated (or dependent) lipase, is a 74 kDa lipolytic enzyme capable of hydrolyzing cholesteryl esters, tri-, di-, and mono-acylglycerols, phospholipids, lysophospholipids, and ceramide(PMID:12454261). The same enzyme is present as a major protein in milk and as a minor constituent in liver, activated macrophages, and endothelial cells(PMID:11733511). Defects in CEL are a cause of maturity-onset diabetes of the young type 8 with exocrine dysfunction (MODY8)(PMID:16369531). The full length protein has 11 glycosylation sites. It has 2 isoforms produced by alternative splicing.