CENPA Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CENPA Recombinant monoclonal antibody (88445-1-RR)

CENPA Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 88445-1-RR

Clone No.260865G5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

CENP A, CENP-A, Histone H3-like centromeric protein A

• 

  WB analysis using 88445-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88445-1-RR (CENPA antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of PC-3 using 88445-1-RR

  Immunofluorescent analysis of (4% PFA) fixed PC-3 cells using CENPA antibody (88445-1-RR, Clone: 260865G5 ) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HCT 116 cells, HeLa cells, MCF-7 cells, A375 cells, Jurkat cells
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88445-1-RR targets CENPA in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25025

  Product name: Recombinant human CENPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-59 aa of BC002703

  Sequence: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTH

• Full Name: centromere protein A
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 16-20 kDa
• GenBank Accession Number: BC002703
• Gene Symbol: CENPA
• Gene ID (NCBI): 1058
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49450
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Centromere protein-A (CENP-A) is a Histone H3-like protein that contains a C-terminal H3-like domain, required for centro-mere localization of CENP-A, and an antigenic N-terminal domain. CENP-A, originally isolated from HeLa cells, is essential for kinetochore targeting of CENP-C. In the presence of DNA, CENP-A forms an octameric complex with histones H4, H2A and H2B. CENP-A specifically localizes to active centromeres and is a component of specialized centromeric nucleosomes, on which kinetochores are assembled. CENP-A is essential for nucleosomal packaging of centromeric DNA at interphase and functions as a centromere formation marker on the chromosome.