CENPB Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• CENPB Recombinant monoclonal antibody, PBS Only (87672-1-PBS)

• 

  WB analysis using 87672-1-RR (same clone as 87672-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87672-1-RR (CENPB antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87672-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 87672-1-RR (same clone as 87672-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 87672-1-RR (CENPB antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 87672-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 87672-1-RR (same clone as 87672-1-PBS)

  WB result of CENPB antibody (87672-1-RR; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-CENPB transfected HeLa cells. This data was developed using the same antibody clone with 87672-1-PBS in a different storage buffer formulation.

CENPB Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 87672-1-PBS

Clone No.253126C5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

CENP B, CENP-B, Centromere protein B

---

Product Information

87672-1-PBS targets CENPB in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag24967

  Product name: Recombinant human CENPB protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 1-180 aa of BC053847

  Sequence: MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASERKYGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASNGWLDRFRRRHGVVSCSGVARARARNAAPRTPAAPASPAAVPSEGSGGSTTGWRAREEQPP

• Full Name: centromere protein B, 80kDa
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 75-80 kDa
• GenBank Accession Number: BC053847
• Gene Symbol: CENPB
• Gene ID (NCBI): 1059
• RRID: AB_3745687
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P07199
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Centromere protein B (CENPB), also known as major centromere autoantigen B, is an autoantigen protein of the cell nucleus. In mammalian centromeres CENPB plays a critical role in the organization of chromatinstructure, but in the absence of CENPB some chromosomes use other redundant proteins to accomplish mitosis (PMID: 14963831). CENPB plays an important role in cell cycle regulation. CENPB is highly expressed in cancer cells helping in high rate proliferation. This antibody detects CENPB protein with a molecular weight of 80 kDa (PMID: 34547289, PMID: 29273057).