CEP290 Monoclonal antibody

CEP290 Monoclonal Antibody for WB, ELISA
Cat No. 67716-1-Ig
Clone No.2C10G2

Host / Isotype

Mouse / IgG2b

Reactivity

Human, rat, mouse

Applications

WB, ELISA

3H11Ag, BBS14, Cancer/testis antigen 87, centrosomal protein 290kDa, Centrosomal protein of 290 kDa, CEP290, CT87, FLJ13615, FLJ21979, JBTS5, JBTS6, KIAA0373, LCA10, MKS4, Nephrocystin 6, rd16, SLSN6, Tumor antigen se2 2

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HSC-T6 cells, HeLa cells, NCCIT cells, K-562 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67716-1-Ig targets CEP290 in WB, ELISA applications and shows reactivity with Human, rat, mouse samples.

Tested Reactivity Human, rat, mouse
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17457

Product name: Recombinant human CEP290 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-237 aa of BC008641

Sequence: QMDSDEMKKILAENSRKITVLQVNEKSLIRQYTTLVELERQLRKENEKQKNELLSMEAEVCEKIGCLQRFKEMAIFKIAALQKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNSDIVSISKKITMLEMKELNERQRAEHCQKMYEHLRTSLKQMEERNFELETKFAEV

Predict reactive species
Full Name centrosomal protein 290kDa
Calculated Molecular Weight 2479 aa, 290 kDa
Observed Molecular Weight290 kDa
GenBank Accession NumberBC008641
Gene Symbol CEP290
Gene ID (NCBI) 80184
RRIDAB_2918499
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO15078
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Studies in the Chlamydomonas model system has shown that the ciliary protein CEP290 is a critical component of these Y-link junctions. Additionally, numerous studies have demonstrated that CEP290's function is critical for IFT-in CEP290 knockdown experiments, many proteins that would normally localize to the cilium fail to do so, and cilium formation is disrupted or absent. Mutations in CEP290 are accountable for cases of nephronophthisis, Leber congenital amaurosis and Joubert syndrome. In IF analtsis of HeLa cells, the white arrows show centrosome and cilium staining. Two isoforms were produced by alternative splicing with predicted MW of 290 and 180 kDa according to UniProt.

Protocols

Product Specific Protocols
WB protocol for CEP290 antibody 67716-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...