CEP57 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• CEP57 Polyclonal antibody, PBS Only (27031-1-PBS)

• 

  WB analysis using 27031-1-AP (same clone as 27031-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 27031-1-AP (CEP57 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 27031-1-PBS in a different storage buffer formulation.

CEP57 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 27031-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

centrosomal protein 57kDa, Centrosomal protein of 57 kDa, FGF2 interacting protein, KIAA0092, PIG8

---

Product Information

27031-1-PBS targets CEP57 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24885

  Product name: Recombinant human CEP57 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 241-500 aa of BC001233

  Sequence: NRLIFEDKATPCVPNARRIKKKKSKPPEKKSSRNYFGAQPHYRLCLGDMPFVAGKSTSPSHAVVANVQLVLHLMKQHSKALCNDRVINSIPLAKQVSSRGGKSKKLSVTPPSSNGINEELSEVLQTLQDEFGQMSFDHQQLAKLIQESPTVELKDKLECELEALVGRMEAKANQITKVRKYQAQLEKQKLEKQKKELKATKKTLDEERNSSSRSGITGTTNKKDFMKLRPGEKRRKNLQLLKDMQSIQNSLQSSSLCWDY

• Full Name: centrosomal protein 57kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: BC001233
• Gene Symbol: CEP57
• Gene ID (NCBI): 9702
• RRID: AB_3742211
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q86XR8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Cep57 is an ubiquitously-expressed protein that functions in spindle assembly, spindle pole integrity and central spindle organization as a microtubule- and centrosome-associated protein. Also, Cep57 is required for centriole duplication, and is highly expressed in prostate cancer cells.