Centrin 1 Recombinant monoclonal antibody, PBS Only (Capture)

Centrin 1 Uni-rAb® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA
Cat No. 85637-2-PBS
Clone No.243013C4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

CETN1, Caltractin isoform 2, CEN1, Centrin-1, CETN

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85637-2-PBS targets Centrin 1 as part of a matched antibody pair:

MP02059-2: 85637-2-PBS capture and 85637-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3529

Product name: Recombinant human CETN1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-172 aa of BC029515

Sequence: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY

Predict reactive species
Full Name centrin, EF-hand protein, 1
Calculated Molecular Weight 172 aa, 20 kDa
Observed Molecular Weight 20 kDa
GenBank Accession NumberBC029515
Gene Symbol Centrin 1
Gene ID (NCBI) 1068
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ12798
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

EF-hand type Ca2+-binding proteins consists of several family members, including Centrin-1, Centrin-2 and Centrin-3. The Centrin proteins are ubiquitously expressed cytoskeletal components that show increased expression during cell differentiation. Centrin-1 plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. Centrin-1 is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle.

Loading...
||
New chat

Able

正在加载,请稍候...