Centrin 1 Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 85637-2-RR (same clone as 85637-2-PBS)

  Human testis tissue was subjected to SDS PAGE followed by western blot with 85637-2-RR (CETN1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85637-2-PBS in a different storage buffer formulation.

• 

  WB analysis using 85637-2-RR (same clone as 85637-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85637-2-RR (CETN1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85637-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array standard curve of MP02059-2

  Cytometric bead array standard curve of MP02059-2, Centrin 1 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 85637-2-PBS. Detection antibody: 85637-1-PBS. Standard: Ag3529. Range: 0.781-100 ng/mL.

• 

  Affinity of 85637-2-RR

  Biolayer interferometry (BLl) kinetic assays of 85637-2-RR against Human Centrin 1 were performed. The affinity constant is 4.38 nM.

Centrin 1 Uni-rAb^® Recombinant Antibody for WB, Cytometric bead array, Indirect ELISA

Cat No. 85637-2-PBS

Clone No.243013C4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Cytometric bead array, Indirect ELISA

Synonyms

CETN1, Caltractin isoform 2, CEN1, Centrin-1, CETN

---

Product Information

85637-2-PBS targets Centrin 1 as part of a matched antibody pair:

MP02059-2: 85637-2-PBS capture and 85637-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3529

  Product name: Recombinant human CETN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC029515

  Sequence: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY

• Full Name: centrin, EF-hand protein, 1
• Calculated Molecular Weight: 172 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC029515
• Gene Symbol: Centrin 1
• Gene ID (NCBI): 1068
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q12798
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

EF-hand type Ca2+-binding proteins consists of several family members, including Centrin-1, Centrin-2 and Centrin-3. The Centrin proteins are ubiquitously expressed cytoskeletal components that show increased expression during cell differentiation. Centrin-1 plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. Centrin-1 is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle.