Centrin 1 Recombinant monoclonal antibody

• 

  WB analysis using 85637-2-RR

  Human testis tissue was subjected to SDS PAGE followed by western blot with 85637-2-RR (CETN1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 85637-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85637-2-RR (CETN1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 85637-2-RR

  Biolayer interferometry (BLl) kinetic assays of 85637-2-RR against Human Centrin 1 were performed. The affinity constant is 4.38 nM.

Centrin 1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85637-2-RR

Clone No.243013C4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

CETN1, Caltractin isoform 2, CEN1, Centrin-1, CETN

---

Tested Applications

• Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85637-2-RR targets Centrin 1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag3529

  Product name: Recombinant human CETN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-172 aa of BC029515

  Sequence: MASGFKKPSAASTGQKRKVAPKPELTEDQKQEVREAFDLFDVDGSGTIDAKELKVAMRALGFEPRKEEMKKMISEVDREGTGKISFNDFLAVMTQKMSEKDTKEEILKAFRLFDDDETGKISFKNLKRVANELGENLTDEELQEMIDEADRDGDGEVNEEEFLRIMKKTSLY

• Full Name: centrin, EF-hand protein, 1
• Calculated Molecular Weight: 172 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC029515
• Gene Symbol: Centrin 1
• Gene ID (NCBI): 1068
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q12798
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

EF-hand type Ca2+-binding proteins consists of several family members, including Centrin-1, Centrin-2 and Centrin-3. The Centrin proteins are ubiquitously expressed cytoskeletal components that show increased expression during cell differentiation. Centrin-1 plays important roles in the determination of centrosome position and segregation, and in the process of microtubule severing. Centrin-1 is localized to the centrosome of interphase cells, and redistributes to the region of the spindle poles during mitosis, reflecting the dynamic behavior of the centrosome during the cell cycle.