CFAP161 Polyclonal antibody

• 

  WB analysis using 33141-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 33141-1-AP (CFAP161 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

CFAP161 Polyclonal Antibody for WB, ELISA

Cat No. 33141-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

C15orf26, Cilia- and flagella-associated protein 161

---

Tested Applications

• Positive WB detected in: human testis tissue, mouse testis tissue, rat testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

33141-1-AP targets CFAP161 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37789

  Product name: Recombinant human CFAP161 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 26-193 aa of NM_173528

  Sequence: MKDFLEKRDKGKLLIQRSRRLKQNLLRPMQLSVTEDGYIHYGDKVMLVNPDDPDTEADVFLRGDLSLCMTPDEIQSHLKDELEVPCGLSAVQAKTPIGRNTFIILSVHRDATGQVLRYGQDFCLGITGGFDNKMLYLSSDHRTLLKSSKRSWLQEVYLTDEVSHVNCW

• Full Name: chromosome 15 open reading frame 26
• Calculated Molecular Weight: 301aa, 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: NM_173528
• Gene Symbol: C15orf26
• Gene ID (NCBI): 161502
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q6P656
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Cilia- and flagella-associated protein 161 (CFAP161) is a protein involved in the formation and function of motile cilia. It is a target gene of the transcription factor FOXJ1, which controls the expression of numerous ciliary components. CFAP161 is highly conserved across species and is essential for the proper function of motile cilia, which are critical for various physiological processes, including mucociliary clearance and sperm motility (PMID: 34172766; 39215164).