CFAP221 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• CFAP221 Polyclonal antibody (32922-1-AP)

• 

  WB analysis using 32922-1-AP

  MG-63 cells were subjected to SDS PAGE followed by western blot with 32922-1-AP (CFAP221 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

CFAP221 Polyclonal Antibody for WB, ELISA

Cat No. 32922-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Cilia- and flagella-associated protein 221, PCDP1, Primary ciliary dyskinesia protein 1

---

Tested Applications

• Positive WB detected in: MG-63 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32922-1-AP targets CFAP221 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag38512

  Product name: Recombinant human hCG_17324 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 265-508 aa of NM_001271049.1

  Sequence: LEEFERLNTLSKKVNVPPEKAMMHINFHRPPAKPKPQKVKEIEYQNLRFPVDLSNPFAVATVLNQEPGKLKIKELREVLDQGTEISKTRQMKEALFEQKVRQDIHEEMENHLKWQVHLGKDPMSFKLKKELTEEWQKACAKYKLDRGDPILDEEFQRLKTEVSHKRVVRNQEEKIKEFHPTFDPLINNTWLSRSRAQKRFQQVARKVMIQGRLFNMLSAVREMDKESILRKIGQAKQSIAQEAN

• Full Name: primary ciliary dyskinesia protein 1
• Calculated Molecular Weight: 97kDa，840a
• Observed Molecular Weight: 100 kDa
• GenBank Accession Number: NM_001271049.1
• Gene Symbol: hCG_17324
• Gene ID (NCBI): 200373
• RRID: AB_3742788
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q4G0U5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CFAP221 (also known as PCDP1) is a crucial structural protein in motile cilia and sperm flagella. It is specifically located within the axillary shaft of the cilia and acts as a "connection bridge" between the adjacent outer doublet microtubules, playing a role in stabilizing the core skeleton of the axillary shaft and coordinating the sliding of microtubules. The loss of this protein's function will disrupt the structural integrity and normal oscillation of the cilia, leading to a genetic disorder known as primary ciliary dyskinesia.