• Featured Product
  • KD/KO Validated

Complement factor D Polyclonal antibody

Complement factor D Polyclonal Antibody for WB, IHC, ELISA
Cat No. 26050-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

CFD, EC:3.4.21.46, DF, complement factor D (adipsin), C3 convertase activator

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inhuman plasma tissue, human placenta tissue, human plasma
Positive IHC detected inhuman stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

26050-1-AP targets Complement factor D in WB, IHC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag23473

Product name: Recombinant human CFD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 87-201 aa of BC057807

Sequence: QPEPSKRLYDVLRAVPHPDSQPDTIDHDLLLLQLSEKATLGPAVRPLPWQRVDRDVAPGTLCDVAGWGIVNHAGRRPDSLQHVLLPVLDRATCNRRTHHDGAITERLMCAESNRR

Predict reactive species
Full Name complement factor D (adipsin)
Calculated Molecular Weight 253 aa, 27 kDa
Observed Molecular Weight 27 kDa
GenBank Accession NumberBC057807
Gene Symbol CFD
Gene ID (NCBI) 1675
RRIDAB_2880352
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP00746
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Complement factor D, also known as adipsin, is a highly specific serine protease. Complement factor D is the rate-limiting enzyme in the alternative pathway of complement. It activates C3 convertase by cleaving factor B, which is a key step in the alternative pathway. Complement factor D catalyzes the cleavage of factor B to generate Ba (non-catalytic chain) and Bb (active catalytic subunit), which together with C3(H2O) (or C3b) constitute the active C3 convertase C3(H2O)Bb (or C3bBb). (PMID: 34566967; PMID: 27775713).

Protocols

Product Specific Protocols
IHC protocol for Complement factor D antibody 26050-1-APDownload protocol
WB protocol for Complement factor D antibody 26050-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Immunol Res

The influences of α-hemolytic Streptococcus on class switching and complement activation of human tonsillar cells in IgA nephropathy.

Authors - Muyao Ye
humanWB

Hypertens Res

Endothelial-derived complement factor D contributes to endothelial dysfunction in malignant nephrosclerosis via local complement activation

Authors - Zheng Wang
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...