Cofilin 2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Cofilin 2 Polyclonal antibody (11848-1-AP)

Cofilin 2 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 11848-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

CFL2, CFL 2, cofilin 2 (muscle), Cofilin2, Cofilin-2

• 

  WB analysis using 11848-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11848-1-AP (Cofilin 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human liver using 11848-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 11848-1-AP (Cofilin 2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of L02 using 11848-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 11848-1-AP (Cofilin 2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 11848-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11848-1-AP (Cofilin 2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 11848-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 11848-1-AP (Cofilin 2 antibody at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 11848-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11848-1-AP (Cofilin 2 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 11848-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 11848-1-AP (Cofilin 2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 11848-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 11848-1-AP (Cofilin 2 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human skeletal muscle using 11848-1-AP

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle tissue slide using 11848-1-AP (Cofilin 2 antibody at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human gliomas using 11848-1-AP

  Immunohistochemical analysis of paraffin-embedded human gliomas using 11848-1-AP (Cofilin 2 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 11848-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 11848-1-AP (Cofilin 2 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human heart using 11848-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 11848-1-AP (Cofilin 2 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of L02 using 11848-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed L02 cells using Cofilin 2 antibody (11848-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Cofilin 2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse skeletal muscle tissue, human liver tissue, L02 cells, mouse liver tissue, mouse lung tissue, rat skeletal muscle tissue
• Positive IHC detected in: human normal colon, human gliomas tissue, human heart tissue, human skeletal muscle tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: L02 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11848-1-AP targets Cofilin 2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2408

  Product name: Recombinant human CFL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-166 aa of BC022876

  Sequence: MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVSLEGKPL

• Full Name: cofilin 2 (muscle)
• Calculated Molecular Weight: 166 aa, 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC022876
• Gene Symbol: Cofilin 2
• Gene ID (NCBI): 1073
• RRID: AB_2080914
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y281
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The Cofilin 2 Polyclonal antibody (Cat# 11848-1-AP) has 3 total citations. These appear in Molecular Therapy, Noncoding RNA Research, and Iranian Journal of Basic Medical Sciences. The associated research fields include cardiac endothelial angiogenesis, antitumor immunity in nasopharyngeal carcinoma, and exosomal miRNA-mediated cardioprotection in myocardial infarction.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Mol Ther; Intercellular transfer of miR-200c-3p impairs the angiogenic capacity of cardiac endothelial cells.; Authors - Lara Ottaviani
human	WB,IHC,IF	Noncoding RNA Res; ADAR1-regulated miR-142-3p/RIG-I axis suppresses antitumor immunity in nasopharyngeal carcinoma; Authors - Haoyuan Xu
rat	WB	Iran J Basic Med Sci; Plasma exosomal miR-142-3p induced by acupuncture protects against heart injury in rats with myocardial infarction by targeting Cofilin 2.; Authors - Yue Zhao