CGGBP1 Monoclonal antibody, PBS Only

• 

  WB analysis using 66524-1-Ig (same clone as 66524-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66524-1-Ig (CGGBP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 66524-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 66524-1-Ig (same clone as 66524-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66524-1-Ig (CGGBP1 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66524-1-PBS in a different storage buffer formulation.

CGGBP1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 66524-1-PBS

Clone No.2F5G9

Host / Isotype

Mouse / IgG1

Reactivity

Human, Rat, mouse

Applications

WB, Indirect ELISA

Synonyms

20 kDa CGG binding protein, CGG binding protein 1, CGGBP, CGGBP1, p20 CGGBP, p20 CGGBP DNA binding protein

---

Product Information

66524-1-PBS targets CGGBP1 in WB, Indirect ELISA applications and shows reactivity with Human, Rat, mouse samples.

• Tested Reactivity: Human, Rat, mouse
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1129

  Product name: Recombinant human CGGBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-167 aa of BC005222

  Sequence: MERFVVTAPPARNRSKTALYVTPLDRVTEFGGELHEDGGKLFCTSCNVVLNHVRKSAISDHLKSKTHTKRKAEFEEQNVRKKQRPLTASLQCNSTAQTEKVSVIQDFVKMCLEANIPLEKADHPAVRAFLSRHVKNGGSIPKSDQLRRTYLPDGYENENQLLNSQDC

• Full Name: CGG triplet repeat binding protein 1
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 19 kDa
• GenBank Accession Number: BC005222
• Gene Symbol: CGGBP1
• Gene ID (NCBI): 8545
• RRID: AB_2881887
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9UFW8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CGGBP1, also named as CGGBP, is a 20 kDa CGG-binding protein. It binds to nonmethylated 5'-d(CGG)(n)-3' trinucleotide repeats in the FMR1 promoter. CGGBP1 may play a role in regulating FMR1 promoter. It is a bona fide midbody protein required for normal abscission and mitosis in general.(PMID:20832400)