Use Able AI chat for product recommendations

CHAD Polyclonal antibody

CHAD Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12963-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Cartilage leucine-rich protein, chondroadherin, SLRR4A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, MCF-7 cells, Jurkat cells
Positive IHC detected inmouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12963-1-AP targets CHAD in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4077

Product name: Recombinant human CHAD protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 25-359 aa of BC036360

Sequence: QNCHCHSDLQHVICDKVGLQKIPKVSEKTKLLNLQRNNFPVLAANSFRAMPNLVSLHLQHCQIREVAAGAFRGLKQLIYLYLSHNDIRVLRAGAFDDLTELTYLYLDHNKVTELPRGLLSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALDDVENLAKFHVDRNQLSSYPSAALSKLRVVEELKLSHNPLKSIPDNAFQSFGRYLETLWLDNTNLEKFSDGAFLGVTTLKHVHLENNRLNQLPSNFPFDSLETLALTNNPWKCTCQLRGLRRWLEAKASRPDATCASPAKFKGQHIRDTDAFRSCKFPTKRSKKAGRH

Predict reactive species
Full Name chondroadherin
Calculated Molecular Weight 359 aa, 40.5 kDa
Observed Molecular Weight 41 kDa
GenBank Accession NumberBC036360
Gene Symbol CHAD
Gene ID (NCBI) 1101
RRIDAB_2244851
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO15335
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Chondroadherin (CHAD), also known as cartilage leucine-rich protein, is a prominent noncollagenous extracellular protein in cartilage. It was first isolated from bovine cartilage. The primary structure of CHAD shows that it belongs to the family of leucine-rich repeat (LRR) proteins. It is expressed at high levels in certain zones of cartilage and also has been detected in bone, tendon, bone marrow, and chondrosarcoma cells. CHAD promotes attachment of chondrocytes, fibroblasts, and osteoblasts, mediated via the integrin alpha2beta1. It has also been shown to bind to collagen type II and both collagen type II and chondroadherin interact with integrin alpha2beta1. Besides, CHAD may play an important role in the regulation of chondrocyte growth and proliferation.

Protocols

Product Specific Protocols
IHC protocol for CHAD antibody 12963-1-APDownload protocol
WB protocol for CHAD antibody 12963-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

SpeciesApplicationTitle
humanWB

Reprod Sci

NFAT Overexpression Correlates with CA72-4 and Poor Prognosis of Ovarian Clear-Cell Carcinoma Subtype.

Authors - Bing Xin

Reviews

    4.0 out of 5
Add a review

1 verified customer reviews

What customers say

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Thomas (Verified Customer) (10-02-2025)

Staining of native bovine articular cartilage. CHAD staining was found to be only in deep zone as expected.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/200
  • Cell Tissue Type: Cartilage
CHAD Antibody Immunofluorescence validation (1/200 dilution) in Cartilage (Cat no:12963-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...