CHAT Polyclonal antibody, PBS Only

• 

  WB analysis of rat brain using 24418-1-AP (same clone as 24418-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 24418-1-AP (CHAT Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24418-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 24418-1-AP (same clone as 24418-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 24418-1-AP (CHAT Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24418-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 24418-1-AP (same clone as 24418-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 24418-1-AP (CHAT Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24418-1-PBS in a different storage buffer formulation.

• 

  IP experiment of rat brain using 24418-1-AP (same clone as 24418-1-PBS)

  IP result of anti-CHAT (IP:24418-1-AP, 4ug; Detection:24418-1-AP 1:2000) with rat brain tissue lysate 1880 ug. This data was developed using the same antibody clone with 24418-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 24418-1-AP (same clone as 24418-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 24418-1-AP (CHAT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24418-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 24418-1-AP (same clone as 24418-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 24418-1-AP (CHAT antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24418-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 24418-1-AP (same clone as 24418-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 24418-1-AP (CHAT antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24418-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 24418-1-AP (same clone as 24418-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24418-1-AP (CHAT Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24418-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 24418-1-AP (same clone as 24418-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24418-1-AP (CHAT Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24418-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 24418-1-AP (same clone as 24418-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using 24418-1-AP (CHAT antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24418-1-PBS in a different storage buffer formulation.

CHAT Polyclonal Antibody for WB, IHC, IF-P, IP, ELISA

Cat No. 24418-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IP, ELISA

Synonyms

CHOACTase, Choline acetylase, choline acetyltransferase, Choline O-acetyltransferase, EC:2.3.1.6

---

Product Information

24418-1-PBS targets CHAT in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19550

  Product name: Recombinant human CHAT protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 281-630 aa of BC130617

  Sequence: SDTHRALQLLHGGGYSKNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMTQSSRKLIRADSVSELPAPRRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPASEKLLLLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPSQGHQP

• Full Name: choline acetyltransferase
• Calculated Molecular Weight: 748 aa, 83 kDa
• Observed Molecular Weight: 60-66 kDa, 45 kDa
• GenBank Accession Number: BC130617
• Gene Symbol: CHAT
• Gene ID (NCBI): 1103
• RRID: AB_2879536
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P28329
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHAT (choline acetyltransferase) belongs to the carnitine/choline acetyltransferase family. It catalyzes the reversible synthesis of acetylcholine (ACh) from acetyl CoA and choline at cholinergic synapses. Defects in CHAT are the cause of congenital myasthenic syndrome with episodic apnea (CMSEA). CHAT is known to to be present exclusively in the cytoplasm of cholinergic neurons and anti-CHAT antibody has been considered as the best marker for cholinergic neurons. It has been observed that CHAT gene generates multiple mRNA splice variants, including peripheral type CHAT (pCHAT) and common type CHAT (cCHAT), encoding 40-55 kDa and 66-70 kDa forms of proteins, respectively.