Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

CHCHD2 Polyclonal antibody

CHCHD2 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 19424-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

C7orf17, CHCHD2, MNRR1, NS2TP

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHT-1080 cells, HEK-293 cells, human adrenal gland tissue, HepG2 cells
Positive IP detected inHepG2 cells
Positive IHC detected inhuman lung cancer tissue, mouse brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19424-1-AP targets CHCHD2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, mouse, drosophila
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13752

Product name: Recombinant human CHCHD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-151 aa of BC003079

Sequence: MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA

Predict reactive species
Full Name coiled-coil-helix-coiled-coil-helix domain containing 2
Calculated Molecular Weight 151 aa, 16 kDa
Observed Molecular Weight 16-18 kDa
GenBank Accession NumberBC003079
Gene Symbol CHCHD2
Gene ID (NCBI) 51142
RRIDAB_10638907
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y6H1
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

CHCHD2 is a widely expressed 16.7-kDa mitochondrion-localized protein. CHCHD2 contains a C-terminal CHCH (coiled-coil helix coiled-coil helix) domain. Mutations in CHCHD2 gene have been reported in autosomal dominant Parkinson's disease (ADPD). CHCHD2 is a bi-organellar mediator of oxidative phosphorylation, playing crucial roles in regulating electron flow in the mitochondrial electron transport chain and acting as a nuclear transcription factor for a cytochrome c oxidase subunit (COX4I2) and itself in response to hypoxic stress. CHCHD2 also regulates cell migration and differentiation, mitochondrial cristae structure, and apoptosis (PMID: 33967741).

Protocols

Product Specific Protocols
IF protocol for CHCHD2 antibody 19424-1-APDownload protocol
IHC protocol for CHCHD2 antibody 19424-1-APDownload protocol
IP protocol for CHCHD2 antibody 19424-1-APDownload protocol
WB protocol for CHCHD2 antibody 19424-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB, IF

Lancet Neurol

CHCHD2 mutations in autosomal dominant late-onset Parkinson's disease: a genome-wide linkage and sequencing study.

Authors - Manabu Funayama
DrosophilaWB

Nat Commun

Loss of Parkinson's disease-associated protein CHCHD2 affects mitochondrial crista structure and destabilizes cytochrome c.

Authors - Hongrui Meng
humanWB

Nat Commun

TDP-43 and PINK1 mediate CHCHD10S59L mutation-induced defects in Drosophila and in vitro.

Authors - Minwoo Baek
WB

J Biomed Sci

Genetic and pharmacologic p32-inhibition rescue CHCHD2-linked Parkinson's disease phenotypes in vivo and in cell models

Authors - Murni Tio
humanWB

Proc Natl Acad Sci U S A

Mitochondrial Nuclear Retrograde Regulator 1 (MNRR1) rescues the cellular phenotype of MELAS by inducing homeostatic mechanisms.

Authors - Siddhesh Aras
humanWB

Cell Death Dis

CHCHD2 rescues the mitochondrial dysfunction in iPSC-derived neurons from patient with Mohr-Tranebjaerg syndrome

Authors - Yihua Huang

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Nurit (Verified Customer) (02-16-2026)

We infected astrocyte progenitor cells (APCs) derived from human iPSCs with lenti virus carrying CHCHD2-IRES-GFP. We were able to detect CHCHD2 in the infected cells and sometime even endogenous CHCHD2 in uninfected cells.

  • Applications: Immunofluorescence, Cell culture
  • Cell Tissue Type: Astrocytes derived from human iPSCs and infected with lenti virus carrying CHCHD2-IRES-GFP.
CHCHD2 Antibody Immunofluorescence,Cell culture validation ( dilution) in Astrocytes derived from human iPSCs and infected with lenti virus carrying CHCHD2-IRES-GFP. (Cat no:19424-1-AP)
FH

Vignesh (Verified Customer) (10-03-2025)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: HEPG2A cells
Loading...
||
New chat

Able

正在加载,请稍候...