Tested Applications
| Positive WB detected in | HT-1080 cells, HEK-293 cells, human adrenal gland tissue, HepG2 cells |
| Positive IP detected in | HepG2 cells |
| Positive IHC detected in | human lung cancer tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
19424-1-AP targets CHCHD2 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, drosophila |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag13752 Product name: Recombinant human CHCHD2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-151 aa of BC003079 Sequence: MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA Predict reactive species |
| Full Name | coiled-coil-helix-coiled-coil-helix domain containing 2 |
| Calculated Molecular Weight | 151 aa, 16 kDa |
| Observed Molecular Weight | 16-18 kDa |
| GenBank Accession Number | BC003079 |
| Gene Symbol | CHCHD2 |
| Gene ID (NCBI) | 51142 |
| RRID | AB_10638907 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y6H1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CHCHD2 is a widely expressed 16.7-kDa mitochondrion-localized protein. CHCHD2 contains a C-terminal CHCH (coiled-coil helix coiled-coil helix) domain. Mutations in CHCHD2 gene have been reported in autosomal dominant Parkinson's disease (ADPD). CHCHD2 is a bi-organellar mediator of oxidative phosphorylation, playing crucial roles in regulating electron flow in the mitochondrial electron transport chain and acting as a nuclear transcription factor for a cytochrome c oxidase subunit (COX4I2) and itself in response to hypoxic stress. CHCHD2 also regulates cell migration and differentiation, mitochondrial cristae structure, and apoptosis (PMID: 33967741).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CHCHD2 antibody 19424-1-AP | Download protocol |
| IHC protocol for CHCHD2 antibody 19424-1-AP | Download protocol |
| IP protocol for CHCHD2 antibody 19424-1-AP | Download protocol |
| WB protocol for CHCHD2 antibody 19424-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The antibody targeting CHCHD2 (MNRR1), catalog number 19424-1-AP, has 52 total citations. Citations appear in journals including Nature Communications, Lancet Neurology, PNAS, EMBO Molecular Medicine, Cell Death & Disease, Science Advances, Human Molecular Genetics, JBC, and others. Research fields span Parkinson's disease, mitochondrial biology, neurodegeneration (Huntington's disease, ALS), cancer, virology (SARS-CoV-2, Zika), cardiomyopathy, and ferroptosis.
| Species | Application | Title |
|---|---|---|
Lancet Neurol CHCHD2 mutations in autosomal dominant late-onset Parkinson's disease: a genome-wide linkage and sequencing study. | ||
Nat Commun Loss of Parkinson's disease-associated protein CHCHD2 affects mitochondrial crista structure and destabilizes cytochrome c. | ||
Nat Commun TDP-43 and PINK1 mediate CHCHD10S59L mutation-induced defects in Drosophila and in vitro. | ||
Nat Commun Mutant huntingtin impairs neurodevelopment in human brain organoids through CHCHD2-mediated neurometabolic failure | ||
Nucleic Acids Res Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2. | ||
J Biomed Sci Genetic and pharmacologic p32-inhibition rescue CHCHD2-linked Parkinson's disease phenotypes in vivo and in cell models |
Reviews
What customers say
Both reviewers gave 5-star ratings. One user successfully used the antibody for immunofluorescence on human iPSC-derived astrocyte progenitor cells infected with a CHCHD2-expressing lentivirus, detecting both overexpressed and endogenous CHCHD2. Another user applied it at 1:500 dilution for Western Blot on HEPG2A cells with positive results. Overall, users report reliable performance across applications including IF and WB, with good sensitivity capable of detecting endogenous protein levels.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Nurit (Verified Customer) (02-16-2026) | We infected astrocyte progenitor cells (APCs) derived from human iPSCs with lenti virus carrying CHCHD2-IRES-GFP. We were able to detect CHCHD2 in the infected cells and sometime even endogenous CHCHD2 in uninfected cells.
 |
Vignesh (Verified Customer) (10-03-2025) |
|
