• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated CHCHD2 Polyclonal antibody

CHCHD2 Polyclonal Antibody for IF/ICC
Cat No. CL488-19424

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC

C7orf17, CHCHD2, NS2TP

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-19424 targets CHCHD2 in IF/ICC applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13752

Product name: Recombinant human CHCHD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-151 aa of BC003079

Sequence: MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA

Predict reactive species
Full Name coiled-coil-helix-coiled-coil-helix domain containing 2
Calculated Molecular Weight 151 aa, 16 kDa
Observed Molecular Weight 16-18 kDa
GenBank Accession NumberBC003079
Gene Symbol CHCHD2
Gene ID (NCBI) 51142
RRIDAB_3084024
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9Y6H1
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

CHCHD2 is a widely expressed 16.7-kDa mitochondrion-localized protein. CHCHD2 contains a C-terminal CHCH (coiled-coil helix coiled-coil helix) domain. Mutations in CHCHD2 gene have been reported in autosomal dominant Parkinson's disease (ADPD). CHCHD2 is a bi-organellar mediator of oxidative phosphorylation, playing crucial roles in regulating electron flow in the mitochondrial electron transport chain and acting as a nuclear transcription factor for a cytochrome c oxidase subunit (COX4I2) and itself in response to hypoxic stress. CHCHD2 also regulates cell migration and differentiation, mitochondrial cristae structure, and apoptosis (PMID: 33967741).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 CHCHD2 antibody CL488-19424Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...