Tested Applications
| Positive WB detected in | HEK-293 cells, rat liver tissue, LNCaP cells, HeLa cells, Jurkat cells, K-562 cells, L02 cells, SMMC-7721 cells, pig liver tissue |
| Positive IHC detected in | human liver cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:1500-1:6000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66302-1-Ig targets CHCHD2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, rat, pig samples.
| Tested Reactivity | human, rat, pig |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24219 Product name: Recombinant human CHCHD2 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-151 aa of BC003079 Sequence: MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA Predict reactive species |
| Full Name | coiled-coil-helix-coiled-coil-helix domain containing 2 |
| Calculated Molecular Weight | 151 aa, 16 kDa |
| Observed Molecular Weight | 17 kDa |
| GenBank Accession Number | BC003079 |
| Gene Symbol | CHCHD2 |
| Gene ID (NCBI) | 51142 |
| RRID | AB_2881685 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q9Y6H1 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
CHCHD2 is a widely expressed 16.7-kDa mitochondrion-localized protein. CHCHD2 contains a C-terminal CHCH (coiled-coil helix coiled-coil helix) domain. Mutations in CHCHD2 gene have been reported in autosomal dominant Parkinson's disease (ADPD). CHCHD2 is a bi-organellar mediator of oxidative phosphorylation, playing crucial roles in regulating electron flow in the mitochondrial electron transport chain and acting as a nuclear transcription factor for a cytochrome c oxidase subunit (COX4I2) and itself in response to hypoxic stress. CHCHD2 also regulates cell migration and differentiation, mitochondrial cristae structure, and apoptosis (PMID: 33967741).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CHCHD2 antibody 66302-1-Ig | Download protocol |
| IHC protocol for CHCHD2 antibody 66302-1-Ig | Download protocol |
| WB protocol for CHCHD2 antibody 66302-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The CHCHD2 Monoclonal antibody (catalog number 66302-1-Ig) has 17 total citations. These appear in journals including Science Advances, Proceedings of the National Academy of Sciences (PNAS), EMBO Journal, EMBO Molecular Medicine, Aging Cell, Acta Neuropathologica Communications, Cell Insight, Human Molecular Genetics, Molecular Biology of the Cell, Biochimica et Biophysica Acta (Bioenerg), bioRxiv, and medRxiv. The associated research fields center on mitochondrial biology and dysfunction, Parkinson's disease, amyotrophic lateral sclerosis (ALS), mitophagy (PINK1-Parkin), mitochondrial cristae structure, and neurodegeneration, with applications mainly in Western blot, immunohistochemistry, and immunofluorescence.
| Species | Application | Title |
|---|---|---|
Proc Natl Acad Sci U S A A nucleolar long "non-coding" RNA encodes a novel protein that functions in response to stress | ||
Proc Natl Acad Sci U S A Mitochondrial Nuclear Retrograde Regulator 1 (MNRR1) rescues the cellular phenotype of MELAS by inducing homeostatic mechanisms. | ||
EMBO J A unified mechanism for mitochondrial damage sensing in PINK1-Parkin-mediated mitophagy. | ||
EMBO Mol Med Mutant CHCHD10 disrupts cytochrome c oxidation and activates mitochondrial retrograde signaling. | ||
Aging Cell Age-Associated Dysregulation of Postsynaptic Mitochondria Perturbs Reinnervation Kinetics.
|
Reviews
What customers say
The product received a 5-star rating from a researcher who used it for Western Blot on a 231 cell line at a 1:500 dilution. The reviewer reported excellent results, noting that the bands were clear and highly sensitive. Overall, the feedback is positive, highlighting the antibody's strong performance and sensitivity in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Vignesh (Verified Customer) (09-19-2025) | The results are excellent, bands are clear and highly sensitive
|
