CHCHD2 Monoclonal antibody, PBS Only

• 

  WB analysis using 66302-1-Ig (same clone as 66302-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66302-1-Ig (CHCHD2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 66302-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 66302-1-Ig (same clone as 66302-1-PBS)

  WB result of CHCHD2 antibody (66302-1-Ig; 1:4000; incubated at room temperature for 1.5 hours) with sh-Control and sh-CHCHD2 transfected HEK-293 cells. This data was developed using the same antibody clone with 66302-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 66302-1-Ig (same clone as 66302-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 66302-1-Ig (CHCHD2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66302-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat liver using 66302-1-Ig (same clone as 66302-1-PBS)

  rat liver tissue were subjected to SDS PAGE followed by western blot with 66302-1-Ig (CHCHD2 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66302-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66302-1-Ig (same clone as 66302-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66302-1-Ig (CHCHD2 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66302-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66302-1-Ig (same clone as 66302-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66302-1-Ig (CHCHD2 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66302-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66302-1-Ig (same clone as 66302-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CHCHD2 antibody (66302-1-Ig, Clone: 2G1G10 ) at dilution of 1:3000 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66302-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

CHCHD2 Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66302-1-PBS

Clone No.2G1G10

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

2G1G10, AAG10, Aging-associated gene 10 protein, C7orf17, Coiled-coil-helix-coiled-coil-helix domain-containing protein 2

---

Product Information

66302-1-PBS targets CHCHD2 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat, pig samples.

• Tested Reactivity: human, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24219

  Product name: Recombinant human CHCHD2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-151 aa of BC003079

  Sequence: MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA

• Full Name: coiled-coil-helix-coiled-coil-helix domain containing 2
• Calculated Molecular Weight: 151 aa, 16 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC003079
• Gene Symbol: CHCHD2
• Gene ID (NCBI): 51142
• RRID: AB_2881685
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q9Y6H1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

CHCHD2 is a widely expressed 16.7-kDa mitochondrion-localized protein. CHCHD2 contains a C-terminal CHCH (coiled-coil helix coiled-coil helix) domain. Mutations in CHCHD2 gene have been reported in autosomal dominant Parkinson's disease (ADPD). CHCHD2 is a bi-organellar mediator of oxidative phosphorylation, playing crucial roles in regulating electron flow in the mitochondrial electron transport chain and acting as a nuclear transcription factor for a cytochrome c oxidase subunit (COX4I2) and itself in response to hypoxic stress. CHCHD2 also regulates cell migration and differentiation, mitochondrial cristae structure, and apoptosis (PMID: 33967741).