• Featured Product
  • KD/KO Validated

CHCHD2 Recombinant monoclonal antibody, PBS Only

CHCHD2 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA
Cat No. 82702-1-PBS
Clone No.4A12

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IF/ICC, Indirect ELISA

HCV NS2 trans-regulated protein, Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, C7orf17, Aging-associated gene 10 protein, AAG10

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

82702-1-PBS targets CHCHD2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag13752

Product name: Recombinant human CHCHD2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-151 aa of BC003079

Sequence: MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMATTAAGVAVGSAVGHTLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCRLANGLA

Predict reactive species
Full Name coiled-coil-helix-coiled-coil-helix domain containing 2
Calculated Molecular Weight 151 aa, 16 kDa
Observed Molecular Weight 16 kDa
GenBank Accession NumberBC003079
Gene Symbol CHCHD2
Gene ID (NCBI) 51142
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9Y6H1
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

CHCHD2 is a widely expressed 16.7-kDa mitochondrion-localized protein. CHCHD2 contains a C-terminal CHCH (coiled-coil helix coiled-coil helix) domain. Mutations in CHCHD2 gene have been reported in autosomal dominant Parkinson's disease (ADPD). CHCHD2 is a bi-organellar mediator of oxidative phosphorylation, playing crucial roles in regulating electron flow in the mitochondrial electron transport chain and acting as a nuclear transcription factor for a cytochrome c oxidase subunit (COX4I2) and itself in response to hypoxic stress. CHCHD2 also regulates cell migration and differentiation, mitochondrial cristae structure, and apoptosis (PMID: 33967741).

Loading...
||
New chat Able
正在加载,请稍候...